GlyCosmos Portal

Submissions

4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9

Summary

UniProt ID

O88819

Gene Symbol

Fut9

Gene ID

[14348]

Organism

Mus musculus (house mouse)

External Links

GlyConnect

Alpha-(1,3)-fucosyltransferase 9

GlyGen

O88819

SwissLipids

SLP:000001437

Re-Glyco

O88819

Annotation

Keyword: Disulfide bond Glycoprotein Glycosyltransferase Golgi apparatus Lipid metabolism Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 33 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
polysaccharide biosynthetic process	IMP	PMID
protein N-linked glycosylation	ISS	GO_REF
protein N-linked glycosylation	ISO	GO_REF
protein N-linked glycosylation	IEA	GO_REF
N-glycan processing	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

lipid biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

macromolecule biosynthetic process [inference]

polysaccharide biosynthetic process

glycoprotein biosynthetic process [inference]

carbohydrate biosynthetic process [inference]

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

Lewis x epitope biosynthetic process

macromolecule metabolic process [inference]

polysaccharide metabolic process [inference]

polysaccharide biosynthetic process

macromolecule biosynthetic process [inference]

polysaccharide biosynthetic process

glycoprotein biosynthetic process [inference]

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

primary metabolic process [inference]

carbohydrate metabolic process [inference]

polysaccharide metabolic process [inference]

polysaccharide biosynthetic process

oligosaccharide metabolic process [inference]

oligosaccharide biosynthetic process

carbohydrate biosynthetic process [inference]

lipid metabolic process [inference]

sphingolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

glycosphingolipid biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

lipid biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

glycosphingolipid biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

Lewis x epitope biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

glycosphingolipid biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation

cell division [inference]

stem cell division [inference]

somatic stem cell division [inference]

neuronal stem cell division

developmental process [inference]

anatomical structure development [inference]

system development [inference]

nervous system development

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

regulation of leukocyte migration [inference]

regulation of cellular extravasation [inference]

regulation of leukocyte tethering or rolling

regulation of locomotion [inference]

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

regulation of cellular extravasation [inference]

regulation of leukocyte tethering or rolling

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of cellular process [inference]

regulation of cell adhesion [inference]

regulation of cell-cell adhesion [inference]

regulation of leukocyte cell-cell adhesion

regulation of leukocyte adhesion to vascular endothelial cell [inference]

regulation of leukocyte tethering or rolling

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

positive regulation of neuron projection development

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

regulation of cellular extravasation [inference]

regulation of leukocyte tethering or rolling

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	EXP	PMID
Golgi membrane	IEA	GO_REF
Golgi apparatus	IDA	PMID
Golgi apparatus	IEA	GO_REF
trans-Golgi network	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

trans-Golgi network membrane

bounding membrane of organelle [inference]

Golgi membrane

organelle subcompartment [inference]

Golgi apparatus subcompartment [inference]

trans-Golgi network

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	ISS	GO_REF
4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	ISO	GO_REF GO_REF
4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	PMID
4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IBA	GO_REF
4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

hexosyltransferase activity [inference]

fucosyltransferase activity [inference]

alpha-(1->3)-fucosyltransferase activity

4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity

binding [inference]

protein binding [inference]

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWVFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDFNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
62	N-linked (GlcNAc...) asparagine			UniProt GlyGen
101	N-linked (GlcNAc...) asparagine			UniProt GlyGen
153	N-linked (GlcNAc...) asparagine	30899004	G80920RR G06110VR	UniProt GlyGen GlyConnect