GlyCosmos Portal

Submissions

Metalloproteinase inhibitor 1

Summary

UniProt ID: P01033
Gene Symbol: TIMP1 CLGI TIMP hCG_29141
Gene ID: 7076
Organism: Homo sapiens (human)

External Links

GlycoProtDB

GPDB0011295

GlyConnect

Metalloproteinase inhibitor 1

GlyGen

P01033

PubChem

P01033

RaftProt

P01033

Re-Glyco

P01033

Annotation

Keyword: 3D-structure Direct protein sequencing Disulfide bond Glycoprotein Growth factor Metal-binding Metalloprotease inhibitor Phosphoprotein Proteomics identification Reference proteome Secreted Signal Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
connective tissue replacement involved in inflammatory response wound healing
positive regulation of cell population proliferation	IDA	PMID
response to hormone	IBA	GO_REF
negative regulation of endopeptidase activity	IDA	PMID
response to cytokine	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to peptide

cellular response to oxygen-containing compound [inference]

cellular response to aldehyde [inference]

cellular response to acetaldehyde

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

multicellular organismal process [inference]

tissue remodeling [inference]

connective tissue replacement [inference]

connective tissue replacement involved in inflammatory response wound healing

developmental process [inference]

anatomical structure development [inference]

animal gross anatomical part developmental process [inference]

animal organ development [inference]

cartilage development

response to stimulus [inference]

response to abiotic stimulus [inference]

response to radiation [inference]

response to light stimulus [inference]

response to UV [inference]

cellular response to UV [inference]

cellular response to UV-A

response to UV-A [inference]

cellular response to UV-A

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

response to endogenous stimulus [inference]

response to hormone

response to peptide hormone

response to chemical [inference]

response to hormone

response to peptide hormone

cellular response to chemical stimulus [inference]

cellular response to peptide

cellular response to oxygen-containing compound [inference]

cellular response to aldehyde [inference]

cellular response to acetaldehyde

response to peptide [inference]

response to nitrogen compound [inference]

response to peptide hormone

response to oxygen-containing compound [inference]

response to peptide hormone

cellular response to oxygen-containing compound [inference]

cellular response to aldehyde [inference]

cellular response to acetaldehyde

response to acetaldehyde [inference]

cellular response to acetaldehyde

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to peptide

cellular response to oxygen-containing compound [inference]

cellular response to aldehyde [inference]

cellular response to acetaldehyde

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of integrin-mediated signaling pathway

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of trophoblast cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration [inference]

negative regulation of trophoblast cell migration

regulation of trophoblast cell migration [inference]

negative regulation of trophoblast cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of trophoblast cell migration

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

negative regulation of biological process [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of trophoblast cell migration

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of peptidase activity [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of trophoblast cell migration

negative regulation of multicellular organismal process [inference]

negative regulation of trophoblast cell migration

negative regulation of reproductive process [inference]

negative regulation of trophoblast cell migration

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of integrin-mediated signaling pathway

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of integrin-mediated signaling pathway

regulation of metabolic process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of peptidase activity [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of peptidase activity [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

negative regulation of proteolysis [inference]

negative regulation of peptidase activity [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of peptidase activity [inference]

negative regulation of peptidase activity [inference]

regulation of endopeptidase activity [inference]

negative regulation of endopeptidase activity

regulation of metallopeptidase activity [inference]

negative regulation of metallopeptidase activity

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of peptidase activity [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

negative regulation of proteolysis [inference]

negative regulation of peptidase activity [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of peptidase activity [inference]

negative regulation of peptidase activity [inference]

regulation of endopeptidase activity [inference]

negative regulation of endopeptidase activity

regulation of metallopeptidase activity [inference]

negative regulation of metallopeptidase activity

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of peptidase activity [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of peptidase activity [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of trophoblast cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration [inference]

negative regulation of trophoblast cell migration

regulation of trophoblast cell migration [inference]

negative regulation of trophoblast cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of trophoblast cell migration

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of trophoblast cell migration

regulation of reproductive process [inference]

negative regulation of reproductive process [inference]

negative regulation of trophoblast cell migration

regulation of molecular function [inference]

negative regulation of molecular function [inference]

negative regulation of catalytic activity

negative regulation of hydrolase activity [inference]

negative regulation of peptidase activity [inference]

regulation of catalytic activity [inference]

negative regulation of catalytic activity

negative regulation of hydrolase activity [inference]

negative regulation of peptidase activity [inference]

regulation of hydrolase activity [inference]

negative regulation of hydrolase activity [inference]

negative regulation of peptidase activity [inference]

regulation of peptidase activity [inference]

negative regulation of peptidase activity [inference]

regulation of endopeptidase activity [inference]

negative regulation of endopeptidase activity

regulation of metallopeptidase activity [inference]

negative regulation of metallopeptidase activity

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	EXP	PMID
extracellular region	NAS	PMID
extracellular region	TAS	Reactome Reactome Reactome Reactome
extracellular region	IDA	PMID
extracellular region	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

external encapsulating structure [inference]

extracellular matrix

basement membrane

membrane-enclosed lumen [inference]

organelle lumen [inference]

vesicle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen [inference]

platelet alpha granule lumen

intracellular organelle lumen [inference]

endoplasmic reticulum lumen

cytoplasmic vesicle lumen [inference]

secretory granule lumen [inference]

platelet alpha granule lumen

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
protease binding	IEA	GO_REF
cytokine activity	IDA	PMID
growth factor activity
metalloendopeptidase inhibitor activity	IDA	PMID PMID
metalloendopeptidase inhibitor activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

protease binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

peptidase regulator activity [inference]

peptidase inhibitor activity

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

endopeptidase regulator activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
53	N-linked (GlcNAc...) (complex) asparagine	16263699 16335952 16740002 19139490 23090970 24190977 26791533 29741879 30237853 32125861 37074911 8053566	G15169WU G70232NH G69521XL G80075MS G11629QQ G25713RA G57776ZS G26271XI G86880BF G90382BL G10944ZI G90093AU G41126SR G77122IZ G79666IR G81263BG G92135MA G31483BB G43734MM G75607BQ G34989PA G81198YO G95835XS G40834TG G02528FI G51413EV G08146BT G22310AV G28156XV G45395BF G88374WZ G70375MX G96079KC G10819WX G14972EH G02030ZB G12580WI G24202BK G43223CG G70087PV G95977AE G08918WF G71146HJ G75983OB G00912UN G11911BT G56284ZY G57081YJ G70441OD G72797UR G70822IO G39841VH G44953PJ G72667IM G76295SF G46691LC G04657PL G87051GH G08293MJ G27058EU G45495MK G84452RH G89417VQ G83460ZZ G82592ZH G41071NU G66504LK G91636VS G19379ID G35253PZ G60923RB G59626AS G08290VR G14994KB G75303RX G70101JE G80920RR G03382KH G42124LM G68318VE G78454JO G11392CL G23863VK G83555HU G90659AW G64409MC G80333GO G83633GK G62765YT G64527OM G47950XN G11870QZ G47644PP G71146MY G05229BF G10256JP G95177YH G02661MY G05049YU G46687AB G31852PQ G20751GZ G23719VF G49874UX G10339FR G11314AS G29880MM G59358BQ G41247ZX G01600VV G36379GD G94854LT G02815KT G42039DE G74724QE G84811LS G92275SC G91028VZ	GlycoProtDB UniProt GlyGen GlyConnect
101	N-linked (GlcNAc...) asparagine	16740002 23090970 24190977 29741879 32125861 37074911 8053566	G79286RS G20312EM G86795LJ G90382BL G10944ZI G90093AU G96577RX G81263BG G51413EV G08146BT G22310AV G28156XV G45395BF G70375MX G96079KC G66163OV G02030ZB G43223CG G83229XP G08918WF G71146HJ G75983OB G61256FT G57081YJ G72797UR G39841VH G72667IM G76295SF G04657PL G25451PN G27058EU G45495MK G84452RH G89417VQ G41071NU G66504LK G91636VS G07755XJ G42962KI G44215PV G06356OH G37868ZX G08290VR G14994KB G75303RX G80920RR G01485JJ G03382KH G42124LM G78454JO G11392CL G23863VK G57818FI G64409MC G80333GO G62765YT G11870QZ G71146MY G05229BF G10256JP G02661MY G46687AB G31852PQ G90575OW G20751GZ G23719VF G49874UX G11314AS G29880MM G59358BQ G41247ZX G01600VV G36379GD G94854LT G42039DE G66538GV G74724QE G84811LS G92275SC G91028VZ G29580WD	GlycoProtDB UniProt GlyGen GlyConnect

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 7** entries
Pathway Name	Organism
Activation of Matrix Metalloproteinases	Homo sapiens
Interleukin-10 signaling	Homo sapiens
Interleukin-4 and Interleukin-13 signaling	Homo sapiens
Platelet degranulation	Homo sapiens
Post-translational protein phosphorylation	Homo sapiens
Regulation of IGF Activity by IGFBP	Homo sapiens
TGFBR3 PTM regulation	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements