GlyCosmos Portal

Submissions

Vasopressin-neurophysin 2-copeptin

Summary

UniProt ID

P01180

Gene Symbol

AVP

Gene ID

280728

Organism

Bos taurus (domestic cattle)

External Links

Re-Glyco: P01180

Annotation

Keyword: 3D-structure Amidation Cleavage on pair of basic residues Direct protein sequencing Disulfide bond Glycoprotein Hormone Reference proteome Secreted Signal Vasoconstrictor

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
maternal aggressive behavior	IBA	GO_REF
positive regulation of systemic arterial blood pressure	IBA	GO_REF
intracellular signal transduction	IBA	GO_REF
vasoconstriction
positive regulation of vasoconstriction	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

intracellular signal transduction

multicellular organismal process [inference]

system process [inference]

circulatory system process [inference]

vascular process in circulatory system [inference]

blood vessel diameter maintenance [inference]

regulation of vasoconstriction [inference]

positive regulation of vasoconstriction

vasoconstriction

behavior [inference]

aggressive behavior [inference]

maternal aggressive behavior

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of vasoconstriction

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of blood circulation [inference]

regulation of vasoconstriction [inference]

positive regulation of vasoconstriction

positive regulation of multicellular organismal process [inference]

positive regulation of vasoconstriction

regulation of biological quality [inference]

regulation of blood pressure [inference]

positive regulation of blood pressure [inference]

positive regulation of systemic arterial blood pressure

regulation of anatomical structure size [inference]

regulation of tube size [inference]

regulation of tube diameter [inference]

blood vessel diameter maintenance [inference]

regulation of vasoconstriction [inference]

positive regulation of vasoconstriction

vasoconstriction

Displaying **all 3** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
secretory granule	IDA	PMID
secretory granule	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule

Displaying **all 3** entries
GO Term	Evidence Code	Reference
neuropeptide hormone activity	IBA	GO_REF
neurohypophyseal hormone activity	IEA	GO_REF
V1A vasopressin receptor binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

G protein-coupled receptor binding [inference]

vasopressin receptor binding [inference]

V1A vasopressin receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

hormone activity [inference]

neuropeptide hormone activity

neurohypophyseal hormone activity

neuropeptide activity [inference]

neuropeptide hormone activity

neurohypophyseal hormone activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

hormone activity [inference]

neuropeptide hormone activity

neurohypophyseal hormone activity

neuropeptide activity [inference]

neuropeptide hormone activity

neurohypophyseal hormone activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPDATLPACFLSLLAFTSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGVGFPRRVRANDRSNATLLDGPSGALLLRLVQLAGAPEPAEPAQPGVY

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites