GlyCosmos Portal

Submissions

Prolactin

Summary

UniProt ID: P01238
Gene Symbol: PRL
Gene ID: 396965
Organism: Sus scrofa (pig)

External Links

PubChem: P01238
Re-Glyco: P01238

Annotation

Keyword: Direct protein sequencing Disulfide bond Glycoprotein Hormone Lactation Phosphoprotein Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of endothelial cell proliferation	IMP	PMID
cell surface receptor signaling pathway	IBA	GO_REF
female pregnancy	IBA	GO_REF
lactation
positive regulation of vascular endothelial growth factor production	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to hypoxia

cellular response to chemical stimulus [inference]

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

reproductive process [inference]

multi-organism reproductive process [inference]

female pregnancy

multicellular organismal process [inference]

multi-multicellular organism process [inference]

female pregnancy

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

gland development [inference]

mammary gland development

response to stimulus [inference]

response to stress [inference]

response to hypoxia [inference]

cellular response to hypoxia

cellular response to stress [inference]

cellular response to hypoxia

response to abiotic stimulus [inference]

response to oxygen levels [inference]

response to decreased oxygen levels [inference]

response to hypoxia [inference]

cellular response to hypoxia

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

response to nutrient levels

response to chemical [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to hypoxia

cellular response to chemical stimulus [inference]

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

localization [inference]

establishment of localization [inference]

transport [inference]

secretion [inference]

body fluid secretion [inference]

lactation

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of lactation

regulation of lactation [inference]

positive regulation of lactation

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of lactation

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of epithelial cell proliferation [inference]

positive regulation of endothelial cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of lactation

positive regulation of developmental process [inference]

positive regulation of lactation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of lactation

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of nitric oxide biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process [inference]

negative regulation of reactive oxygen species biosynthetic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

negative regulation of hormone metabolic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of lipid metabolic process [inference]

negative regulation of steroid metabolic process [inference]

negative regulation of steroid biosynthetic process [inference]

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process [inference]

negative regulation of small molecule metabolic process [inference]

negative regulation of progesterone biosynthetic process

negative regulation of reactive oxygen species metabolic process [inference]

negative regulation of hydrogen peroxide metabolic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

negative regulation of reactive oxygen species biosynthetic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of developmental process [inference]

positive regulation of developmental process [inference]

positive regulation of lactation

regulation of multicellular organismal development [inference]

regulation of lactation [inference]

positive regulation of lactation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of nitric oxide biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process [inference]

negative regulation of reactive oxygen species biosynthetic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

regulation of ketone biosynthetic process [inference]

regulation of progesterone biosynthetic process [inference]

negative regulation of progesterone biosynthetic process

regulation of nitric oxide biosynthetic process [inference]

negative regulation of nitric oxide biosynthetic process

regulation of hormone biosynthetic process [inference]

negative regulation of hormone biosynthetic process [inference]

regulation of estrogen biosynthetic process [inference]

negative regulation of estrogen biosynthetic process

regulation of progesterone biosynthetic process [inference]

negative regulation of progesterone biosynthetic process

regulation of lipid biosynthetic process [inference]

regulation of steroid biosynthetic process [inference]

negative regulation of steroid biosynthetic process [inference]

regulation of estrogen biosynthetic process [inference]

negative regulation of estrogen biosynthetic process

regulation of progesterone biosynthetic process [inference]

negative regulation of progesterone biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process [inference]

regulation of reactive oxygen species biosynthetic process [inference]

regulation of hydrogen peroxide biosynthetic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

negative regulation of reactive oxygen species biosynthetic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of nitric oxide biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process [inference]

negative regulation of reactive oxygen species biosynthetic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

negative regulation of hormone metabolic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of lipid metabolic process [inference]

negative regulation of steroid metabolic process [inference]

negative regulation of steroid biosynthetic process [inference]

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process [inference]

negative regulation of small molecule metabolic process [inference]

negative regulation of progesterone biosynthetic process

negative regulation of reactive oxygen species metabolic process [inference]

negative regulation of hydrogen peroxide metabolic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

negative regulation of reactive oxygen species biosynthetic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

regulation of ketone metabolic process [inference]

regulation of ketone biosynthetic process [inference]

regulation of progesterone biosynthetic process [inference]

negative regulation of progesterone biosynthetic process

regulation of hormone metabolic process [inference]

negative regulation of hormone metabolic process [inference]

negative regulation of hormone biosynthetic process [inference]

regulation of hormone biosynthetic process [inference]

negative regulation of hormone biosynthetic process [inference]

regulation of estrogen biosynthetic process [inference]

negative regulation of estrogen biosynthetic process

regulation of progesterone biosynthetic process [inference]

negative regulation of progesterone biosynthetic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

regulation of small molecule metabolic process [inference]

regulation of ketone biosynthetic process [inference]

regulation of progesterone biosynthetic process [inference]

negative regulation of progesterone biosynthetic process

negative regulation of small molecule metabolic process [inference]

negative regulation of progesterone biosynthetic process

regulation of primary metabolic process [inference]

regulation of lipid metabolic process [inference]

regulation of steroid metabolic process [inference]

negative regulation of steroid metabolic process [inference]

negative regulation of steroid biosynthetic process [inference]

regulation of steroid biosynthetic process [inference]

negative regulation of steroid biosynthetic process [inference]

regulation of estrogen biosynthetic process [inference]

negative regulation of estrogen biosynthetic process

regulation of progesterone biosynthetic process [inference]

negative regulation of progesterone biosynthetic process

negative regulation of lipid metabolic process [inference]

negative regulation of steroid metabolic process [inference]

negative regulation of steroid biosynthetic process [inference]

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process [inference]

regulation of lipid biosynthetic process [inference]

regulation of steroid biosynthetic process [inference]

negative regulation of steroid biosynthetic process [inference]

regulation of estrogen biosynthetic process [inference]

negative regulation of estrogen biosynthetic process

regulation of progesterone biosynthetic process [inference]

negative regulation of progesterone biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process [inference]

regulation of nitric oxide metabolic process [inference]

regulation of nitric oxide biosynthetic process [inference]

negative regulation of nitric oxide biosynthetic process

regulation of reactive oxygen species metabolic process [inference]

regulation of hydrogen peroxide metabolic process [inference]

negative regulation of hydrogen peroxide metabolic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

regulation of hydrogen peroxide biosynthetic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

regulation of reactive oxygen species biosynthetic process [inference]

regulation of hydrogen peroxide biosynthetic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

negative regulation of reactive oxygen species biosynthetic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

negative regulation of reactive oxygen species metabolic process [inference]

negative regulation of hydrogen peroxide metabolic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

negative regulation of reactive oxygen species biosynthetic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of epithelial cell proliferation [inference]

positive regulation of endothelial cell proliferation

regulation of epithelial cell proliferation [inference]

regulation of endothelial cell proliferation [inference]

positive regulation of endothelial cell proliferation

positive regulation of epithelial cell proliferation [inference]

positive regulation of endothelial cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of epithelial cell proliferation [inference]

positive regulation of endothelial cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of nitric oxide biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process [inference]

negative regulation of reactive oxygen species biosynthetic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

negative regulation of hormone metabolic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of lipid metabolic process [inference]

negative regulation of steroid metabolic process [inference]

negative regulation of steroid biosynthetic process [inference]

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process [inference]

negative regulation of small molecule metabolic process [inference]

negative regulation of progesterone biosynthetic process

negative regulation of reactive oxygen species metabolic process [inference]

negative regulation of hydrogen peroxide metabolic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

negative regulation of reactive oxygen species biosynthetic process [inference]

negative regulation of hydrogen peroxide biosynthetic process

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of lactation

regulation of multicellular organismal development [inference]

regulation of lactation [inference]

positive regulation of lactation

regulation of biological quality [inference]

regulation of hormone levels [inference]

regulation of hormone metabolic process [inference]

negative regulation of hormone metabolic process [inference]

negative regulation of hormone biosynthetic process [inference]

regulation of hormone biosynthetic process [inference]

negative regulation of hormone biosynthetic process [inference]

regulation of estrogen biosynthetic process [inference]

negative regulation of estrogen biosynthetic process

regulation of progesterone biosynthetic process [inference]

negative regulation of progesterone biosynthetic process

regulation of body fluid levels [inference]

body fluid secretion [inference]

lactation

regulation of lactation [inference]

positive regulation of lactation

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying **all 3** entries
GO Term	Evidence Code	Reference
prolactin receptor binding	IBA	GO_REF
hormone activity	IBA	GO_REF
hormone activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

prolactin receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

hormone activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

hormone activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDNRGSSQKGSLLLLLLLVSNLFLCKSVASLPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
61	N-linked (GlcNAc...) asparagine; partial			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Growth hormone receptor signaling	Sus scrofa
Prolactin receptor signaling	Sus scrofa

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements