Submissions
GlyTouCan
Glycan Structure Repository
GlyComb
Glycoconjugate Repository
GlycoPOST
Glycomics MS raw data Repository
UniCarb-DR
Glycomics MS Repository for glycan annotations from GlycoWorkbench
LM-GlycoRepo
Repository for lectin-assisted multimodality data
All Resources
Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / OrganismsTools
SugarDrawer
GlycanBuilder
Glycan Converters
GlycoMaple
GlycomeAtlas
LM-GlycomeAtlas
GALAXY
MCAW
GlycoSim
GRable
Guidelines
MIRAGE
Interferon gamma
Summary
- UniProt ID
- P01581
- Gene Symbol
-
- Ifng
- Gene ID
- 25712
- Organism
- Rattus norvegicus (Norway rat)
Annotation
- Keyword
- Antiviral defense Cytokine Glycoprotein Growth regulation Pyrrolidone carboxylic acid Reference proteome Secreted Signal
Gene Ontology (GO)
| GO Term | Evidence Code | Reference |
|---|---|---|
| negative regulation of transcription by RNA polymerase II | ||
| microglial cell activation | ||
| microglial cell activation | ||
| microglial cell activation | ||
| neutrophil apoptotic process |
GO Hierarchy
- positive regulation of MHC class II biosynthetic process
- positive regulation of nitric oxide biosynthetic process
- positive regulation of MHC class II biosynthetic process
- positive regulation of cellular respiration
- positive regulation of MHC class II biosynthetic process
- positive regulation of nitric oxide biosynthetic process
- positive regulation of MHC class II biosynthetic process
- positive regulation of MHC class II biosynthetic process
- positive regulation of nitric oxide biosynthetic process
- positive regulation of MHC class II biosynthetic process
- positive regulation of cellular respiration
- positive regulation of MHC class II biosynthetic process
- positive regulation of MHC class II biosynthetic process
- positive regulation of MHC class II biosynthetic process
- positive regulation of nitric oxide biosynthetic process
- positive regulation of MHC class II biosynthetic process
- positive regulation of cellular respiration
biological process
immune system process [inference]
cellular process [inference]
cell activation [inference]
signal transduction [inference]
cellular developmental process [inference]
multicellular organismal process [inference]
developmental process [inference]
response to stimulus [inference]
biological regulation [inference]
regulation of biological process [inference]
regulation of immune system process [inference]
positive regulation of immune system process [inference]
regulation of leukocyte activation [inference]
regulation of immune effector process [inference]
regulation of immune response
regulation of hemopoiesis [inference]
regulation of signaling [inference]
regulation of localization [inference]
regulation of protein localization [inference]
regulation of transport [inference]
positive regulation of biological process [inference]
positive regulation of immune system process [inference]
positive regulation of cellular process [inference]
positive regulation of metabolic process [inference]
positive regulation of biosynthetic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression
positive regulation of macromolecule metabolic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression
positive regulation of response to stimulus [inference]
positive regulation of transport [inference]
positive regulation of developmental process [inference]
positive regulation of multicellular organismal process [inference]
negative regulation of biological process [inference]
regulation of response to stimulus [inference]
positive regulation of response to stimulus [inference]
regulation of immune response
regulation of developmental process [inference]
regulation of cell differentiation [inference]
positive regulation of developmental process [inference]
regulation of multicellular organismal development [inference]
regulation of cellular process [inference]
signal transduction [inference]
regulation of cell communication [inference]
regulation of metabolic process [inference]
regulation of biosynthetic process [inference]
positive regulation of biosynthetic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression
regulation of macromolecule biosynthetic process [inference]
regulation of gene expression [inference]
regulation of cytokine production [inference]
regulation of production of molecular mediator of immune response [inference]
positive regulation of gene expression
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression
negative regulation of metabolic process [inference]
positive regulation of metabolic process [inference]
positive regulation of biosynthetic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression
positive regulation of macromolecule metabolic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression
regulation of catabolic process [inference]
regulation of phosphorus metabolic process [inference]
regulation of macromolecule metabolic process [inference]
regulation of macromolecule biosynthetic process [inference]
regulation of gene expression [inference]
regulation of cytokine production [inference]
regulation of production of molecular mediator of immune response [inference]
positive regulation of gene expression
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression
positive regulation of macromolecule metabolic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression
regulation of protein metabolic process [inference]
regulation of RNA metabolic process [inference]
regulation of small molecule metabolic process [inference]
regulation of primary metabolic process [inference]
regulation of transmembrane transport [inference]
regulation of cell population proliferation [inference]
regulation of cell differentiation [inference]
positive regulation of cellular process [inference]
positive regulation of metabolic process [inference]
positive regulation of biosynthetic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression
positive regulation of macromolecule metabolic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression
negative regulation of cellular process [inference]
regulation of cell activation [inference]
regulation of cellular localization [inference]
regulation of multicellular organismal process [inference]
regulation of cytokine production [inference]
regulation of cell activation [inference]
positive regulation of multicellular organismal process [inference]
regulation of multicellular organismal development [inference]
| GO Term | Evidence Code | Reference |
|---|---|---|
| extracellular region | ||
| extracellular region | ||
| extracellular region | ||
| extracellular region | ||
| obsolete extracellular space |
|
|
| GO Term | Evidence Code | Reference |
|---|---|---|
| cytokine activity | ||
| cytokine activity | ||
| cytokine activity | ||
| cytokine activity | ||
| cytokine activity |
GO Hierarchy
Sequence
MSATRRVLVLQLCLMALSGCYCQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Glycosylation Sites
Feature
: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt
Pathway
| Pathway Name | Organism |
|---|---|
| IFNG signaling activates MAPKs | Rattus norvegicus |
| Interferon gamma signaling | Rattus norvegicus |
| Regulation of IFNG signaling | Rattus norvegicus |
Disease
| DO ID | Disease Name | Source |
|---|---|---|
| DOID:0050855 | renal fibrosis | |
| DOID:11204 | allergic conjunctivitis | |
| DOID:12140 | Chagas disease | |
| DOID:3070 | high grade glioma | |
| DOID:4481 | allergic rhinitis | |
| DOID:5199 | ureteral obstruction | |
| DOID:9744 | type 1 diabetes mellitus |
