GlyCosmos Portal

Submissions

Interleukin-3

Summary

UniProt ID: P01586
Gene Symbol: Il3 Csfmu Il-3
Gene ID: 16187
Organism: Mus musculus (house mouse)

External Links

GlyGen: P01586
PubChem: P01586
Re-Glyco: P01586

Annotation

Keyword: 3D-structure Cytokine Disulfide bond Glycoprotein Growth factor Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 27 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
regulation of cell growth	ISO	GO_REF
regulation of cell growth	IGI	PMID
response to hypoxia	IGI	PMID
positive regulation of myeloid leukocyte differentiation	IGI	PMID PMID
regulation of glycolytic process	IGI	PMID

GO Hierarchy

biological process

immune system process [inference]

immune response

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway

interleukin-3-mediated signaling pathway

extrinsic apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway in absence of ligand

cell surface receptor signaling pathway via STAT

signal transduction in absence of ligand [inference]

extrinsic apoptotic signaling pathway in absence of ligand

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway in absence of ligand

cell death [inference]

programmed cell death [inference]

apoptotic process [inference]

myeloid cell apoptotic process

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

myeloid leukocyte differentiation [inference]

monocyte differentiation

mononuclear cell differentiation [inference]

monocyte differentiation

myeloid cell differentiation [inference]

myeloid leukocyte differentiation [inference]

monocyte differentiation

cell development [inference]

hemopoiesis

embryonic hemopoiesis

developmental process [inference]

anatomical structure development [inference]

cell development [inference]

hemopoiesis

embryonic hemopoiesis

animal gross anatomical part developmental process [inference]

animal organ development [inference]

embryonic organ development [inference]

embryonic hemopoiesis

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

myeloid leukocyte differentiation [inference]

monocyte differentiation

mononuclear cell differentiation [inference]

monocyte differentiation

myeloid cell differentiation [inference]

myeloid leukocyte differentiation [inference]

monocyte differentiation

cell development [inference]

hemopoiesis

embryonic hemopoiesis

response to stimulus [inference]

response to stress [inference]

response to hypoxia

immune response

response to abiotic stimulus [inference]

response to oxygen levels [inference]

response to decreased oxygen levels [inference]

response to hypoxia

response to endogenous stimulus [inference]

response to hormone

response to chemical [inference]

response to hormone

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of mast cell apoptotic process

positive regulation of immune system process [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of mast cell apoptotic process [inference]

negative regulation of mast cell apoptotic process

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of JNK cascade [inference]

positive regulation of JNK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of growth [inference]

regulation of cell growth

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mast cell proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of multicellular organismal process [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of mast cell apoptotic process

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of autophagy

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of mast cell apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of mast cell apoptotic process

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of JNK cascade [inference]

positive regulation of JNK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of developmental process [inference]

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway

interleukin-3-mediated signaling pathway

extrinsic apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway in absence of ligand

cell surface receptor signaling pathway via STAT

signal transduction in absence of ligand [inference]

extrinsic apoptotic signaling pathway in absence of ligand

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway in absence of ligand

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of JNK cascade [inference]

positive regulation of JNK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of autophagy

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of autophagy

regulation of autophagy [inference]

negative regulation of autophagy

regulation of nucleotide catabolic process [inference]

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process

regulation of carbohydrate catabolic process [inference]

regulation of glycolytic process

regulation of generation of precursor metabolites and energy [inference]

regulation of glycolytic process

regulation of phosphorus metabolic process [inference]

regulation of nucleotide metabolic process [inference]

regulation of nucleotide catabolic process [inference]

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process

regulation of purine nucleotide metabolic process [inference]

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process

regulation of ATP metabolic process [inference]

regulation of glycolytic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of small molecule metabolic process [inference]

regulation of nucleotide metabolic process [inference]

regulation of nucleotide catabolic process [inference]

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process

regulation of purine nucleotide metabolic process [inference]

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process

regulation of ATP metabolic process [inference]

regulation of glycolytic process

regulation of primary metabolic process [inference]

regulation of carbohydrate metabolic process [inference]

regulation of carbohydrate catabolic process [inference]

regulation of glycolytic process

regulation of nucleobase-containing compound metabolic process [inference]

regulation of nucleotide metabolic process [inference]

regulation of nucleotide catabolic process [inference]

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process

regulation of purine nucleotide metabolic process [inference]

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process

regulation of ATP metabolic process [inference]

regulation of glycolytic process

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mast cell proliferation

regulation of leukocyte proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mast cell proliferation

regulation of mast cell proliferation [inference]

positive regulation of mast cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

regulation of myeloid cell apoptotic process [inference]

regulation of mast cell apoptotic process [inference]

negative regulation of mast cell apoptotic process

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of mast cell apoptotic process

negative regulation of apoptotic process

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of mast cell apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of mast cell apoptotic process

regulation of leukocyte apoptotic process [inference]

regulation of mast cell apoptotic process [inference]

negative regulation of mast cell apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of mast cell apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of mast cell apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of mast cell apoptotic process

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mast cell proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of autophagy

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of mast cell apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of mast cell apoptotic process

regulation of cellular component organization [inference]

regulation of cell growth

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytokine activity	ISO	GO_REF GO_REF
cytokine activity	IDA	PMID PMID PMID PMID PMID PMID PMID PMID
cytokine activity	IBA	GO_REF
interleukin-3 receptor binding	ISO	GO_REF
interleukin-3 receptor binding	IPI	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

interleukin-3 receptor binding

growth factor receptor binding [inference]

interleukin-3 receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVLASSTTSIHTMLLLLLMLFHLGLQASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
42	N-linked (GlcNAc...) asparagine	1445902		UniProt GlyGen
112	N-linked (GlcNAc...) asparagine; partial	1445902		UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Interleukin receptor SHC signaling	Mus musculus
Interleukin-3, Interleukin-5 and GM-CSF signaling	Mus musculus
RAF/MAP kinase cascade	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements