GlyCosmos Portal

Submissions

Granulocyte-macrophage colony-stimulating factor

Summary

UniProt ID: P01587
Gene Symbol: Csf2 Csfgm
Gene ID: 12981
Organism: Mus musculus (house mouse)

External Links

PubChem: P01587
Re-Glyco: P01587

Annotation

Keyword: Cytokine Direct protein sequencing Disulfide bond Glycoprotein Growth factor Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 46 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
histamine secretion	ISO	GO_REF
embryonic placenta development	IMP	PMID
immune response	IEA	GO_REF
cell surface receptor signaling pathway via JAK-STAT	ISO	GO_REF
cell surface receptor signaling pathway via JAK-STAT	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response

leukocyte activation [inference]

myeloid leukocyte activation [inference]

myeloid dendritic cell activation [inference]

myeloid dendritic cell differentiation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

myeloid leukocyte activation [inference]

myeloid dendritic cell activation [inference]

myeloid dendritic cell differentiation

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

granulocyte-macrophage colony-stimulating factor signaling pathway

cell surface receptor signaling pathway via STAT

cell surface receptor signaling pathway via JAK-STAT

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

myeloid leukocyte differentiation [inference]

granulocyte differentiation [inference]

neutrophil differentiation

myeloid dendritic cell differentiation

mononuclear cell differentiation [inference]

dendritic cell differentiation

myeloid dendritic cell differentiation

myeloid cell differentiation

myeloid leukocyte differentiation [inference]

granulocyte differentiation [inference]

neutrophil differentiation

myeloid dendritic cell differentiation

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

myeloid leukocyte activation [inference]

myeloid dendritic cell activation [inference]

myeloid dendritic cell differentiation

developmental process [inference]

anatomical structure development [inference]

animal gross anatomical part developmental process [inference]

animal organ development [inference]

embryonic organ development [inference]

embryonic placenta development

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

myeloid leukocyte differentiation [inference]

granulocyte differentiation [inference]

neutrophil differentiation

myeloid dendritic cell differentiation

mononuclear cell differentiation [inference]

dendritic cell differentiation

myeloid dendritic cell differentiation

myeloid cell differentiation

myeloid leukocyte differentiation [inference]

granulocyte differentiation [inference]

neutrophil differentiation

myeloid dendritic cell differentiation

response to stimulus [inference]

immune response

response to chemical [inference]

response to peptide [inference]

response to cytokine [inference]

cellular response to cytokine stimulus [inference]

cellular response to granulocyte macrophage colony-stimulating factor stimulus

response to granulocyte macrophage colony-stimulating factor [inference]

cellular response to granulocyte macrophage colony-stimulating factor stimulus

localization [inference]

establishment of localization [inference]

transport [inference]

fluid transport [inference]

epithelial fluid transport

secretion [inference]

histamine secretion

transepithelial transport [inference]

epithelial fluid transport

nitrogen compound transport [inference]

histamine transport [inference]

histamine secretion

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

positive regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration

regulation of circadian rhythm [inference]

regulation of circadian sleep/wake cycle [inference]

regulation of circadian sleep/wake cycle, sleep

positive regulation of biological process [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of podosome assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of podosome assembly

positive regulation of cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

positive regulation of cellular component organization [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of podosome assembly

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of podosome assembly

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of developmental process [inference]

regulation of cell differentiation [inference]

regulation of macrophage derived foam cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

positive regulation of cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

granulocyte-macrophage colony-stimulating factor signaling pathway

cell surface receptor signaling pathway via STAT

cell surface receptor signaling pathway via JAK-STAT

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

regulation of interleukin-23 production [inference]

positive regulation of interleukin-23 production

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

regulation of interleukin-23 production [inference]

positive regulation of interleukin-23 production

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of cell population proliferation

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation

regulation of leukocyte proliferation [inference]

positive regulation of leukocyte proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of podosome assembly

regulation of podosome assembly [inference]

positive regulation of podosome assembly

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of podosome assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of podosome assembly

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

regulation of podosome assembly [inference]

positive regulation of podosome assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of podosome assembly

regulation of cell differentiation [inference]

regulation of macrophage derived foam cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

positive regulation of cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of podosome assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of podosome assembly

positive regulation of cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

positive regulation of cellular component organization [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of podosome assembly

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of podosome assembly

positive regulation of cell motility [inference]

positive regulation of cell migration

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of podosome assembly

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

regulation of podosome assembly [inference]

positive regulation of podosome assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of podosome assembly

regulation of plasma membrane bounded cell projection organization [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

regulation of podosome assembly [inference]

positive regulation of podosome assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of podosome assembly

regulation of protein-containing complex assembly [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of podosome assembly

regulation of podosome assembly [inference]

positive regulation of podosome assembly

positive regulation of cellular component organization [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of podosome assembly

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of podosome assembly

regulation of cell motility [inference]

regulation of cell migration [inference]

positive regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

regulation of interleukin-23 production [inference]

positive regulation of interleukin-23 production

regulation of behavior [inference]

regulation of circadian sleep/wake cycle [inference]

regulation of circadian sleep/wake cycle, sleep

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-23 production

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISO	GO_REF GO_REF
extracellular region	IDA	PMID PMID
extracellular region	IEA	GO_REF GO_REF GO_REF
obsolete extracellular space
granulocyte macrophage colony-stimulating factor receptor complex	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex [inference]

plasma membrane signaling receptor complex [inference]

granulocyte macrophage colony-stimulating factor receptor complex

membrane protein complex [inference]

plasma membrane protein complex [inference]

plasma membrane signaling receptor complex [inference]

granulocyte macrophage colony-stimulating factor receptor complex

cellular anatomical structure [inference]

extracellular region

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytokine activity	ISS	GO_REF
cytokine activity	ISO	GO_REF GO_REF
cytokine activity	IDA	PMID PMID
cytokine activity	IBA	GO_REF
cytokine activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

granulocyte macrophage colony-stimulating factor receptor binding

growth factor receptor binding [inference]

granulocyte macrophage colony-stimulating factor receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MWLQNLLFLGIVVYSLSAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
22	O-linked (GalNAc...) serine	UniProt
27	O-linked (GalNAc...) threonine	UniProt
83	N-linked (GlcNAc...) asparagine	UniProt
92	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Interleukin receptor SHC signaling	Mus musculus
Interleukin-3, Interleukin-5 and GM-CSF signaling	Mus musculus
RAF/MAP kinase cascade	Mus musculus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:12120	pulmonary alveolar proteinosis	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements