GlyCosmos Portal

Submissions

Thy-1 membrane glycoprotein

Summary

UniProt ID: P01830
Gene Symbol: Thy-1 Thy1
Gene ID: 24832
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen: P01830
RaftProt: P01830
Re-Glyco: P01830

Annotation

Keyword: Cell membrane Direct protein sequencing Disulfide bond GPI-anchor Immunoglobulin domain Phosphoprotein Pyrrolidone carboxylic acid Reference proteome Sialic acid Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 37 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
angiogenesis	ISS	GO_REF
angiogenesis	ISO	GO_REF
regulation of cell-matrix adhesion	ISO	GO_REF
positive regulation of cellular extravasation	ISO	GO_REF
negative regulation of protein kinase activity	IDA	PMID

GO Hierarchy

biological process

immune system process [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

leukocyte activation [inference]

myeloid leukocyte activation [inference]

mast cell activation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

myeloid leukocyte activation [inference]

mast cell activation

cell communication [inference]

cell-cell signaling

cell adhesion [inference]

cell-cell adhesion

heterotypic cell-cell adhesion

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

integrin-mediated signaling pathway

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

phosphorylation [inference]

protein phosphorylation [inference]

protein autophosphorylation

macromolecule metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

protein phosphorylation [inference]

protein autophosphorylation

macromolecule modification [inference]

protein modification process [inference]

protein phosphorylation [inference]

protein autophosphorylation

primary metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

protein phosphorylation [inference]

protein autophosphorylation

cellular developmental process [inference]

cell development [inference]

neuron development [inference]

photoreceptor cell development [inference]

eye photoreceptor cell development [inference]

retinal cone cell development

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

receptor clustering

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization

cellular component assembly [inference]

cell junction assembly [inference]

cell-substrate junction assembly [inference]

focal adhesion assembly

cell junction organization [inference]

cell junction assembly [inference]

cell-substrate junction assembly [inference]

focal adhesion assembly

cell-substrate junction organization [inference]

cell-substrate junction assembly [inference]

focal adhesion assembly

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

myeloid leukocyte activation [inference]

mast cell activation

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

anatomical structure development [inference]

cell development [inference]

neuron development [inference]

photoreceptor cell development [inference]

eye photoreceptor cell development [inference]

retinal cone cell development

cellular developmental process [inference]

cell development [inference]

neuron development [inference]

photoreceptor cell development [inference]

eye photoreceptor cell development [inference]

retinal cone cell development

response to stimulus [inference]

response to stress [inference]

response to wounding [inference]

response to axon injury

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein localization to membrane [inference]

receptor clustering

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

receptor clustering

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of cellular extravasation [inference]

positive regulation of cellular extravasation

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of lymphocyte activation [inference]

regulation of T cell activation [inference]

positive regulation of T cell activation

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

signaling [inference]

cell-cell signaling

regulation of localization [inference]

regulation of transport [inference]

regulation of transmembrane transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of release of sequestered calcium ion into cytosol [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of monoatomic ion transport [inference]

regulation of metal ion transport [inference]

regulation of calcium ion transport [inference]

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of calcium ion transmembrane transport [inference]

regulation of release of sequestered calcium ion into cytosol [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of release of sequestered calcium ion into cytosol [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of monoatomic ion transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of monoatomic ion transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of cellular extravasation [inference]

positive regulation of cellular extravasation

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of cellular component biogenesis [inference]

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of cellular component organization [inference]

positive regulation of cell-substrate junction organization [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of monoatomic ion transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of fibroblast proliferation

negative regulation of metabolic process [inference]

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of neuron projection regeneration

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of neuron projection regeneration

negative regulation of multicellular organismal process [inference]

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of neuron projection regeneration

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of neuron projection regeneration [inference]

negative regulation of neuron projection regeneration

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of axonogenesis [inference]

negative regulation of axonogenesis

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

regulation of neurogenesis [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of neuron projection regeneration

regulation of neuron projection regeneration [inference]

negative regulation of neuron projection regeneration

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

integrin-mediated signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of metabolic process [inference]

negative regulation of metabolic process [inference]

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

positive regulation of metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

regulation of phosphorus metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of phosphorylation [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

positive regulation of protein phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

regulation of peptidyl-tyrosine phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

regulation of kinase activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

positive regulation of protein phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

regulation of peptidyl-tyrosine phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

positive regulation of protein phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

regulation of peptidyl-tyrosine phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

regulation of cell adhesion [inference]

regulation of cell-substrate adhesion [inference]

regulation of cell-matrix adhesion

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

regulation of focal adhesion assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

regulation of transmembrane transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of release of sequestered calcium ion into cytosol [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of fibroblast proliferation

regulation of fibroblast proliferation [inference]

negative regulation of fibroblast proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

regulation of cellular component biogenesis [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

regulation of cell junction assembly [inference]

regulation of cell-substrate junction assembly [inference]

regulation of focal adhesion assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

regulation of neurogenesis [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of peptidyl-tyrosine phosphorylation

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of cellular component biogenesis [inference]

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of cellular component organization [inference]

positive regulation of cell-substrate junction organization [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of fibroblast proliferation

negative regulation of metabolic process [inference]

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of lymphocyte activation [inference]

regulation of T cell activation [inference]

positive regulation of T cell activation

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development [inference]

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

negative regulation of neuron projection development [inference]

regulation of axonogenesis [inference]

negative regulation of axonogenesis

regulation of neuron projection regeneration [inference]

negative regulation of neuron projection regeneration

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development [inference]

positive regulation of cellular component organization [inference]

positive regulation of cell-substrate junction organization [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

regulation of cell-substrate junction organization [inference]

regulation of cell-substrate junction assembly [inference]

regulation of focal adhesion assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell-substrate junction organization [inference]

positive regulation of focal adhesion assembly

regulation of cell junction assembly [inference]

regulation of cell-substrate junction assembly [inference]

regulation of focal adhesion assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

regulation of cellular response to stress [inference]

regulation of neuron projection regeneration [inference]

negative regulation of neuron projection regeneration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of cellular extravasation [inference]

positive regulation of cellular extravasation

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of lymphocyte activation [inference]

regulation of T cell activation [inference]

positive regulation of T cell activation

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

negative regulation of multicellular organismal process [inference]

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

regulation of molecular function [inference]

negative regulation of molecular function [inference]

negative regulation of catalytic activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of molecular function [inference]

positive regulation of catalytic activity [inference]

positive regulation of hydrolase activity [inference]

positive regulation of GTPase activity

regulation of catalytic activity [inference]

positive regulation of catalytic activity [inference]

positive regulation of hydrolase activity [inference]

positive regulation of GTPase activity

negative regulation of catalytic activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of hydrolase activity [inference]

regulation of GTPase activity [inference]

positive regulation of GTPase activity

positive regulation of hydrolase activity [inference]

positive regulation of GTPase activity

regulation of transferase activity [inference]

regulation of kinase activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

Displaying entries **1 - 5** of 25 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
endoplasmic reticulum	ISO	GO_REF
cytosol	IDA	PMID
plasma membrane	IDA	PMID
plasma membrane	IEA	GO_REF GO_REF
external side of plasma membrane	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

plasma membrane region [inference]

apical plasma membrane

cell projection membrane [inference]

neuron projection membrane [inference]

membrane microdomain [inference]

membrane raft

cell junction [inference]

synapse [inference]

glutamatergic synapse

site of polarized growth [inference]

growth cone

leading edge membrane [inference]

neuron projection membrane [inference]

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

dendrite

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

cell body membrane [inference]

neuronal cell body membrane

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
GTPase activator activity	IDA	PMID
GTPase activator activity	IBA	GO_REF
integrin binding	ISS	PMID GO_REF
integrin binding	ISO	GO_REF
integrin binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

integrin binding

enzyme binding

kinase binding [inference]

protein kinase binding

cell adhesion molecule binding [inference]

integrin binding

lipid binding [inference]

phospholipid binding [inference]

GPI anchor binding

glycolipid binding [inference]

GPI anchor binding

protein-containing complex binding [inference]

integrin binding

carbohydrate derivative binding [inference]

glycolipid binding [inference]

GPI anchor binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

GTPase activator activity

nucleoside-triphosphatase regulator activity [inference]

GTPase regulator activity [inference]

GTPase activator activity

molecular function activator activity [inference]

enzyme activator activity [inference]

GTPase activator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNPVISITLLLSVLQMSRGQRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKCGGISLLVQNTSWLLLLLLSLSFLQATDFISL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
42	N-linked (GlcNAc...) (complex) asparagine; alternate N-linked (GlcNAc...) (high mannose) asparagine; alternate N-linked (GlcNAc...) asparagine; alternate	24090084 34106099 6118137	G80920RR G03574QJ G62765YT G28541PG G31852PQ G39446WN G41247ZX G02815KT G92050GC G20956ZV G28681TP	UniProt GlyGen
93	N-linked (GlcNAc...) (complex) asparagine; alternate N-linked (GlcNAc...) asparagine; alternate	24090084 34106099 6118137	G79941IJ G12580WI G44953PJ G19379ID G60923RB G68318VE G83555HU G48975GN G50073PQ G97459BD G45504EY G27622TD G56555MU G14548ZL G62765YT G30159WR G88725PI G25987BV G82680EC G02815KT G55220VL	UniProt GlyGen
117	N-linked (GlcNAc...) (high mannose) asparagine; in brain; alternate N-linked (GlcNAc...) (hybrid) asparagine; in brain; alternate	24090084 6118137	G60923RB G88725PI G02815KT	UniProt GlyGen