GlyCosmos Portal

Submissions

Apolipoprotein A-II

Summary

UniProt ID: P02652
Gene Symbol: APOA2
Gene ID: 336
Organism: Homo sapiens (human)

External Links

GlyGen: P02652
PubChem: P02652
RaftProt: P02652
Re-Glyco: P02652

Annotation

Keyword: Cleavage on pair of basic residues Direct protein sequencing Disulfide bond Glycoprotein HDL Host-virus interaction Lipid transport Oxidation Phosphoprotein Proteomics identification Pyrrolidone carboxylic acid Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 32 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of cytokine production involved in immune response	IDA	PMID
triglyceride metabolic process	TAS	PMID
phosphatidylcholine biosynthetic process	IDA	PMID
cholesterol metabolic process
phospholipid catabolic process	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

phosphatidylcholine metabolic process [inference]

phosphatidylcholine biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

phospholipid catabolic process

organophosphate metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

phosphatidylcholine metabolic process [inference]

phosphatidylcholine biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

phospholipid catabolic process

organophosphate catabolic process [inference]

phospholipid catabolic process

organophosphate biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

catabolic process [inference]

lipid catabolic process [inference]

phospholipid catabolic process

glycerolipid catabolic process [inference]

acylglycerol catabolic process [inference]

diacylglycerol catabolic process

organophosphate catabolic process [inference]

phospholipid catabolic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

glycerolipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

organophosphate biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

macromolecule metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

protein oxidation

peptidyl-amino acid modification [inference]

peptidyl-methionine modification

lipoprotein metabolic process

macromolecule modification [inference]

protein modification process [inference]

protein oxidation

peptidyl-amino acid modification [inference]

peptidyl-methionine modification

primary metabolic process [inference]

lipid metabolic process [inference]

neutral lipid metabolic process [inference]

acylglycerol metabolic process [inference]

triglyceride metabolic process

diacylglycerol metabolic process [inference]

diacylglycerol catabolic process

acylglycerol catabolic process [inference]

diacylglycerol catabolic process

neutral lipid catabolic process [inference]

acylglycerol catabolic process [inference]

diacylglycerol catabolic process

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

phosphatidylcholine metabolic process [inference]

phosphatidylcholine biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

phospholipid catabolic process

steroid metabolic process [inference]

sterol metabolic process [inference]

cholesterol metabolic process

lipid biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

glycerolipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

lipid catabolic process [inference]

phospholipid catabolic process

glycerolipid catabolic process [inference]

acylglycerol catabolic process [inference]

diacylglycerol catabolic process

glycerolipid metabolic process [inference]

acylglycerol metabolic process [inference]

triglyceride metabolic process

diacylglycerol metabolic process [inference]

diacylglycerol catabolic process

acylglycerol catabolic process [inference]

diacylglycerol catabolic process

glycerophospholipid metabolic process [inference]

phosphatidylcholine metabolic process [inference]

phosphatidylcholine biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

glycerolipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

glycerolipid catabolic process [inference]

acylglycerol catabolic process [inference]

diacylglycerol catabolic process

protein metabolic process [inference]

protein modification process [inference]

protein oxidation

peptidyl-amino acid modification [inference]

peptidyl-methionine modification

lipoprotein metabolic process

small molecule metabolic process [inference]

alcohol metabolic process [inference]

secondary alcohol metabolic process [inference]

cholesterol metabolic process

cellular response to stimulus [inference]

cellular response to lipoprotein particle stimulus

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

protein-containing complex assembly [inference]

protein-lipid complex assembly [inference]

plasma lipoprotein particle assembly [inference]

high-density lipoprotein particle assembly

protein-containing complex organization [inference]

protein-containing complex remodeling [inference]

protein-lipid complex remodeling [inference]

plasma lipoprotein particle remodeling [inference]

protein-containing complex assembly [inference]

protein-lipid complex assembly [inference]

plasma lipoprotein particle assembly [inference]

high-density lipoprotein particle assembly

protein-lipid complex organization [inference]

protein-lipid complex remodeling [inference]

plasma lipoprotein particle remodeling [inference]

protein-lipid complex assembly [inference]

plasma lipoprotein particle assembly [inference]

high-density lipoprotein particle assembly

plasma lipoprotein particle organization [inference]

plasma lipoprotein particle remodeling [inference]

plasma lipoprotein particle assembly [inference]

high-density lipoprotein particle assembly

multicellular organismal process [inference]

plasma lipoprotein particle clearance [inference]

high-density lipoprotein particle clearance

plasma lipoprotein particle organization [inference]

plasma lipoprotein particle remodeling [inference]

plasma lipoprotein particle assembly [inference]

high-density lipoprotein particle assembly

homeostatic process [inference]

chemical homeostasis [inference]

lipid homeostasis [inference]

sterol homeostasis [inference]

cholesterol homeostasis

response to stimulus [inference]

response to chemical [inference]

response to oxygen-containing compound [inference]

response to carbohydrate [inference]

response to monosaccharide [inference]

response to hexose [inference]

response to glucose

cellular response to stimulus [inference]

cellular response to lipoprotein particle stimulus

localization [inference]

establishment of localization [inference]

transport [inference]

lipid transport [inference]

phospholipid transport [inference]

phospholipid efflux

sterol transport [inference]

cholesterol transport

organophosphate ester transport [inference]

phospholipid transport [inference]

phospholipid efflux

organic hydroxy compound transport [inference]

sterol transport [inference]

cholesterol transport

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of immune effector process [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of immune effector process [inference]

negative regulation of immune effector process [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of production of molecular mediator of immune response [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of cytokine production involved in immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of localization [inference]

regulation of transport [inference]

regulation of lipid transport [inference]

negative regulation of lipid transport [inference]

negative regulation of sterol transport [inference]

negative regulation of cholesterol transport

negative regulation of cholesterol import

regulation of sterol transport [inference]

negative regulation of sterol transport [inference]

negative regulation of cholesterol transport

negative regulation of cholesterol import

regulation of cholesterol transport [inference]

negative regulation of cholesterol transport

negative regulation of cholesterol import

regulation of cholesterol import [inference]

negative regulation of cholesterol import

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

negative regulation of transport [inference]

negative regulation of lipid transport [inference]

negative regulation of sterol transport [inference]

negative regulation of cholesterol transport

negative regulation of cholesterol import

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of phagocytosis

regulation of lipid localization [inference]

regulation of lipid transport [inference]

negative regulation of lipid transport [inference]

negative regulation of sterol transport [inference]

negative regulation of cholesterol transport

negative regulation of cholesterol import

regulation of sterol transport [inference]

negative regulation of sterol transport [inference]

negative regulation of cholesterol transport

negative regulation of cholesterol import

regulation of cholesterol transport [inference]

negative regulation of cholesterol transport

negative regulation of cholesterol import

regulation of cholesterol import [inference]

negative regulation of cholesterol import

negative regulation of lipid localization [inference]

negative regulation of lipid transport [inference]

negative regulation of sterol transport [inference]

negative regulation of cholesterol transport

negative regulation of cholesterol import

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of catabolic process [inference]

positive regulation of lipid catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of lipid metabolic process [inference]

positive regulation of lipid catabolic process

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of immune effector process [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of lipid metabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of cellular component organization [inference]

negative regulation of very-low-density lipoprotein particle remodeling

negative regulation of transport [inference]

negative regulation of lipid transport [inference]

negative regulation of sterol transport [inference]

negative regulation of cholesterol transport

negative regulation of cholesterol import

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

negative regulation of very-low-density lipoprotein particle remodeling

negative regulation of lipid localization [inference]

negative regulation of lipid transport [inference]

negative regulation of sterol transport [inference]

negative regulation of cholesterol transport

negative regulation of cholesterol import

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

regulation of cytokine production involved in immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of interleukin-8 production [inference]

positive regulation of interleukin-8 production

regulation of production of molecular mediator of immune response [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of cytokine production involved in immune response [inference]

negative regulation of cytokine production involved in immune response

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of lipid metabolic process [inference]

negative regulation of lipid catabolic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of catabolic process [inference]

positive regulation of lipid catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of lipid metabolic process [inference]

positive regulation of lipid catabolic process

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process

positive regulation of catabolic process [inference]

positive regulation of lipid catabolic process

regulation of lipid catabolic process [inference]

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

regulation of cytokine production involved in immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of interleukin-8 production [inference]

positive regulation of interleukin-8 production

regulation of production of molecular mediator of immune response [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of cytokine production involved in immune response [inference]

negative regulation of cytokine production involved in immune response

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of primary metabolic process [inference]

regulation of lipid metabolic process [inference]

negative regulation of lipid metabolic process [inference]

negative regulation of lipid catabolic process

positive regulation of lipid metabolic process [inference]

positive regulation of lipid catabolic process

regulation of lipid catabolic process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of catabolic process [inference]

positive regulation of lipid catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of lipid metabolic process [inference]

positive regulation of lipid catabolic process

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of lipid metabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of cellular component organization [inference]

negative regulation of very-low-density lipoprotein particle remodeling

regulation of cellular component organization [inference]

regulation of very-low-density lipoprotein particle remodeling [inference]

negative regulation of very-low-density lipoprotein particle remodeling

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of phagocytosis

negative regulation of cellular component organization [inference]

negative regulation of very-low-density lipoprotein particle remodeling

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of phagocytosis

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

regulation of cytokine production involved in immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of interleukin-8 production [inference]

positive regulation of interleukin-8 production

regulation of very-low-density lipoprotein particle remodeling [inference]

negative regulation of very-low-density lipoprotein particle remodeling

regulation of system process [inference]

regulation of digestive system process [inference]

regulation of intestinal absorption [inference]

regulation of intestinal lipid absorption [inference]

regulation of intestinal cholesterol absorption

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in immune response

negative regulation of very-low-density lipoprotein particle remodeling

regulation of biological quality [inference]

regulation of protein stability

protein stabilization

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	EXP	PMID
extracellular region	NAS	PMID
extracellular region	TAS	Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
extracellular region	IEA	GO_REF GO_REF GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

protein-containing complex [inference]

protein-lipid complex [inference]

lipoprotein particle [inference]

plasma lipoprotein particle [inference]

high-density lipoprotein particle

spherical high-density lipoprotein particle

triglyceride-rich plasma lipoprotein particle [inference]

very-low-density lipoprotein particle

chylomicron

extracellular protein-containing complex [inference]

plasma lipoprotein particle [inference]

high-density lipoprotein particle

spherical high-density lipoprotein particle

triglyceride-rich plasma lipoprotein particle [inference]

very-low-density lipoprotein particle

chylomicron

cellular anatomical structure [inference]

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

endoplasmic reticulum lumen

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

blood microparticle

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
signaling receptor binding	IPI	PMID
lipid carrier activity	IDA	PMID
phospholipid binding	IDA	PMID
high-density lipoprotein particle binding	IBA	GO_REF
high-density lipoprotein particle binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding

apolipoprotein receptor binding

lipoprotein particle receptor binding [inference]

high-density lipoprotein particle receptor binding

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

lipid binding

steroid binding [inference]

sterol binding [inference]

cholesterol binding

phospholipid binding

phosphatidylcholine binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

phosphatidylcholine binding

alcohol binding [inference]

cholesterol binding

quaternary ammonium group binding [inference]

phosphatidylcholine binding

protein-containing complex binding [inference]

protein-lipid complex binding [inference]

lipoprotein particle binding [inference]

high-density lipoprotein particle binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

lipase inhibitor activity

enzyme activator activity [inference]

phosphatidylcholine-sterol O-acyltransferase activator activity

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

molecular function activator activity [inference]

enzyme activator activity [inference]

phosphatidylcholine-sterol O-acyltransferase activator activity

signaling receptor activator activity [inference]

receptor ligand activity

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

lipase inhibitor activity

molecular carrier activity [inference]

lipid carrier activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	PubMed ID	GlyTouCan ID	Source
27	23584533	G57321FI	GlyGen
32	30459171	G43417UB	GlyGen
35	30459171	G53434XO G43417UB	GlyGen
42	23584533 25813380 30459171	G29068FM G57321FI	GlyGen
73	25813380	G57321FI	GlyGen
81	25813380	G57321FI	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
Chylomicron assembly	Homo sapiens
Chylomicron remodeling	Homo sapiens
PPARA activates gene expression	Homo sapiens
Post-translational protein phosphorylation	Homo sapiens
Regulation of IGF Activity by IGFBP	Homo sapiens
Retinoid metabolism and transport	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements