GlyCosmos Portal

Submissions

Rhodopsin

Summary

UniProt ID: P02699
Gene Symbol: RHO
Gene ID: 509933
Organism: Bos taurus (domestic cattle)

External Links

GlyConnect

Rhodopsin

PubChem

P02699

Re-Glyco

P02699

Annotation

Keyword: 3D-structure Acetylation Cell projection Direct protein sequencing Disulfide bond G-protein coupled receptor Glycoprotein Metal-binding Palmitate Phosphoprotein Reference proteome Retinal protein Transmembrane helix Vision Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of 20 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
microtubule cytoskeleton organization
G protein-coupled receptor signaling pathway	IBA	GO_REF
G protein-coupled receptor signaling pathway	IEA	GO_REF GO_REF
visual perception	IEA	GO_REF GO_REF
phototransduction	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

microtubule-based process [inference]

microtubule cytoskeleton organization

signal transduction [inference]

G protein-coupled receptor signaling pathway

G protein-coupled opsin signaling pathway

phototransduction

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression

light absorption [inference]

absorption of visible light

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation [inference]

glutamatergic neuron differentiation [inference]

retinal bipolar neuron differentiation [inference]

rod bipolar cell differentiation

cellular response to stimulus [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus

G protein-coupled opsin signaling pathway

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

microtubule cytoskeleton organization

organelle assembly [inference]

membraneless organelle assembly [inference]

podosome assembly

cellular component assembly [inference]

protein-containing complex assembly [inference]

podosome assembly

organelle assembly [inference]

membraneless organelle assembly [inference]

podosome assembly

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

podosome assembly

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

sensory perception [inference]

sensory perception of light stimulus [inference]

visual perception

photoreceptor cell maintenance

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation [inference]

glutamatergic neuron differentiation [inference]

retinal bipolar neuron differentiation [inference]

rod bipolar cell differentiation

locomotion [inference]

taxis [inference]

thermotaxis

response to stimulus [inference]

response to external stimulus [inference]

detection of external stimulus [inference]

detection of light stimulus [inference]

phototransduction

detection of visible light [inference]

phototransduction, visible light

detection of temperature stimulus [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

response to abiotic stimulus [inference]

response to temperature stimulus [inference]

detection of temperature stimulus [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

thermotaxis

response to radiation [inference]

response to light stimulus

detection of light stimulus [inference]

phototransduction

detection of visible light [inference]

phototransduction, visible light

response to light intensity

cellular response to light stimulus

G protein-coupled opsin signaling pathway

cellular response to radiation [inference]

cellular response to light stimulus

G protein-coupled opsin signaling pathway

detection of abiotic stimulus [inference]

detection of light stimulus [inference]

phototransduction

detection of visible light [inference]

phototransduction, visible light

detection of temperature stimulus [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus

G protein-coupled opsin signaling pathway

detection of stimulus [inference]

detection of external stimulus [inference]

detection of light stimulus [inference]

phototransduction

detection of visible light [inference]

phototransduction, visible light

detection of temperature stimulus [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

detection of abiotic stimulus [inference]

detection of light stimulus [inference]

phototransduction

detection of visible light [inference]

phototransduction, visible light

detection of temperature stimulus [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

detection of stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

cellular response to stimulus [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus

G protein-coupled opsin signaling pathway

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

G protein-coupled opsin signaling pathway

phototransduction

Displaying entries **1 - 5** of 24 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	TAS	Reactome
photoreceptor outer segment	IBA	GO_REF
photoreceptor outer segment	IEA	GO_REF GO_REF
plasma membrane	ISS	GO_REF
plasma membrane	IDA	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex [inference]

plasma membrane signaling receptor complex [inference]

G protein-coupled receptor complex

membrane protein complex [inference]

plasma membrane protein complex [inference]

plasma membrane signaling receptor complex [inference]

G protein-coupled receptor complex

cellular anatomical structure [inference]

photoreceptor outer segment

rod photoreceptor outer segment

membrane

organelle membrane [inference]

photoreceptor disc membrane

bounding membrane of organelle [inference]

Golgi membrane

ciliary membrane [inference]

photoreceptor outer segment membrane

plasma membrane region [inference]

cell projection membrane [inference]

ciliary membrane [inference]

photoreceptor outer segment membrane

cell junction [inference]

anchoring junction [inference]

cell-cell junction

sperm midpiece

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
G-protein alpha-subunit binding	IPI	PMID
opsin binding	IDA	PMID
guanyl-nucleotide exchange factor activity	IDA	PMID
11-cis retinal binding	IDA	PMID PMID PMID
G protein-coupled photoreceptor activity	IDA	PMID PMID PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

lipid binding [inference]

isoprenoid binding [inference]

retinoid binding [inference]

retinal binding [inference]

11-cis retinal binding

small molecule binding [inference]

vitamin binding [inference]

retinal binding [inference]

11-cis retinal binding

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity [inference]

G protein-coupled photoreceptor activity

photoreceptor activity [inference]

G protein-coupled photoreceptor activity

molecular function regulator activity [inference]

enzyme regulator activity [inference]

nucleoside-triphosphatase regulator activity [inference]

GTPase regulator activity [inference]

guanyl-nucleotide exchange factor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
2	N-linked (GlcNAc...) asparagine	11425302 15327956 15491621 16908857 18818650 26526852 468821 6759163		UniProt
15	N-linked (GlcNAc...) asparagine	11425302 11972040 15327956 15491621 16908857 18818650 21389983 22198838 23579341 25205354 26526852 468821 6759163		UniProt
unknown		447724 468821 9492758	G08520NM G33609NS G23453IV G53168IY G75896PD G60145BJ G61751GZ	GlyConnect

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
Activation of the phototransduction cascade	Bos taurus
G alpha (i) signalling events	Bos taurus
Inactivation, recovery and regulation of the phototransduction cascade	Bos taurus
Opsins	Bos taurus
The canonical retinoid cycle in rods (twilight vision)	Bos taurus
VxPx cargo-targeting to cilium	Bos taurus