GlyCosmos Portal

Submissions

Chromogranin-A

Summary

UniProt ID: P04404
Gene Symbol: CHGA
Gene ID: 397540
Organism: Sus scrofa (pig)

External Links

GlyConnect

Chromogranin a

PubChem

P04404

Re-Glyco

P04404

Annotation

Keyword: Amidation Calcium Cleavage on pair of basic residues Cytoplasmic vesicle Direct protein sequencing Disulfide bond Oxidation Phosphoprotein Proteoglycan Reference proteome Secreted Signal Sulfation

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mast cell chemotaxis	ISS	GO_REF
negative regulation of catecholamine secretion	ISS	GO_REF
negative regulation of catecholamine secretion	IBA	GO_REF
defense response to bacterium	IBA	GO_REF
mast cell degranulation	ISS	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

leukocyte degranulation [inference]

mast cell degranulation

leukocyte activation [inference]

myeloid leukocyte activation [inference]

mast cell activation

leukocyte migration [inference]

leukocyte chemotaxis [inference]

mast cell chemotaxis

myeloid leukocyte migration [inference]

mast cell migration [inference]

mast cell chemotaxis

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

myeloid leukocyte activation [inference]

mast cell activation

vesicle-mediated transport [inference]

exocytosis [inference]

regulated exocytosis [inference]

leukocyte degranulation [inference]

mast cell degranulation

cell motility [inference]

cell migration [inference]

leukocyte migration [inference]

leukocyte chemotaxis [inference]

mast cell chemotaxis

myeloid leukocyte migration [inference]

mast cell migration [inference]

mast cell chemotaxis

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

mast cell chemotaxis

export from cell [inference]

secretion by cell [inference]

exocytosis [inference]

regulated exocytosis [inference]

leukocyte degranulation [inference]

mast cell degranulation

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

myeloid leukocyte activation [inference]

mast cell activation

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

mast cell chemotaxis

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to bacterium

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

exocytosis [inference]

regulated exocytosis [inference]

leukocyte degranulation [inference]

mast cell degranulation

secretion [inference]

secretion by cell [inference]

exocytosis [inference]

regulated exocytosis [inference]

leukocyte degranulation [inference]

mast cell degranulation

export from cell [inference]

secretion by cell [inference]

exocytosis [inference]

regulated exocytosis [inference]

leukocyte degranulation [inference]

mast cell degranulation

establishment of localization in cell [inference]

leukocyte degranulation [inference]

mast cell degranulation

establishment of organelle localization [inference]

mast cell degranulation

organelle localization [inference]

establishment of organelle localization [inference]

mast cell degranulation

vacuolar localization [inference]

lysosome localization [inference]

mast cell degranulation

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

negative regulation of signaling [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization [inference]

regulation of protein transport [inference]

regulation of protein secretion [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

regulation of insulin secretion [inference]

negative regulation of insulin secretion

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

negative regulation of establishment of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

negative regulation of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

regulation of transport [inference]

regulation of secretion [inference]

regulation of peptide secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

negative regulation of secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

regulation of catecholamine secretion [inference]

negative regulation of catecholamine secretion

regulation of protein secretion [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

regulation of insulin secretion [inference]

negative regulation of insulin secretion

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

negative regulation of transport [inference]

negative regulation of secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

negative regulation of amine transport [inference]

negative regulation of catecholamine secretion

regulation of protein transport [inference]

regulation of protein secretion [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

regulation of insulin secretion [inference]

negative regulation of insulin secretion

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

regulation of amine transport [inference]

regulation of catecholamine secretion [inference]

negative regulation of catecholamine secretion

negative regulation of amine transport [inference]

negative regulation of catecholamine secretion

regulation of peptide transport [inference]

regulation of peptide secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of dense core granule biogenesis

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

negative regulation of transport [inference]

negative regulation of secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

negative regulation of amine transport [inference]

negative regulation of catecholamine secretion

negative regulation of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

negative regulation of establishment of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

regulation of cellular process [inference]

regulation of cell communication [inference]

negative regulation of cell communication [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

regulation of cellular component biogenesis [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of dense core granule biogenesis

regulation of dense core granule biogenesis [inference]

positive regulation of dense core granule biogenesis

positive regulation of cellular process [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of dense core granule biogenesis

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

regulation of catecholamine secretion [inference]

negative regulation of catecholamine secretion

regulation of protein secretion [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

regulation of insulin secretion [inference]

negative regulation of insulin secretion

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

negative regulation of protein secretion [inference]

negative regulation of insulin secretion

regulation of biological quality [inference]

regulation of hormone levels [inference]

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
transport vesicle	IEA	GO_REF
secretory granule	ISS	GO_REF
secretory granule	IEA	GO_REF
chromaffin granule	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle

secretory vesicle [inference]

secretory granule

dense core granule [inference]

neuronal dense core vesicle

chromaffin granule

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle

secretory vesicle [inference]

secretory granule

dense core granule [inference]

neuronal dense core vesicle

chromaffin granule

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle

secretory vesicle [inference]

secretory granule

dense core granule [inference]

neuronal dense core vesicle

chromaffin granule

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

SAAALALLLCAGQVIALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERSHQQKKQSSYEDELSEVLEKQNDQAELKEGTEEASSKEAAEKRGDSKEVEKNDEDADGAKPQASLEPPXXXEAEDQTPGEEEAASTHPLASLPSKKRPGAQAEEDHEGPSQGPVDREKGPSAEQGPQAEREEEEEAEAGEKAVPEEEGPRSEAFDSHPSLGYKEMQRGWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRGGKRGEPAQEEEERLSEEWENAKRWSKMDRLAKELTAEKRLQGEEEEEEEEEDPDRSMKLSFRAPAYGFRGPGLQLRRGWRPSSREDSVEAGLPLQVRXYLEEKKEEEGSANRRPEDQELESLSAIEAELEKVAPQLQSLRRG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
413	O-linked (Xyl...) (chondroitin sulfate) serine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements