GlyCosmos Portal

Submissions

Sodium/potassium-transporting ATPase subunit beta-1

Summary

UniProt ID: P05027
Gene Symbol: ATP1B1
Gene ID: 396898
Organism: Sus scrofa (pig)

External Links

PubChem: P05027
Re-Glyco: P05027

Annotation

Keyword: 3D-structure Cell adhesion Cell membrane Disulfide bond Glutathionylation Glycoprotein Innate immunity Phosphoprotein Reference proteome Signal-anchor Sodium/potassium transport Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 35 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
intracellular calcium ion homeostasis	IEA	GO_REF
intracellular sodium ion homeostasis	IDA	PMID
intracellular sodium ion homeostasis	IBA	GO_REF
intracellular sodium ion homeostasis	IEA	GO_REF
cell adhesion

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

innate immune response

cellular process [inference]

cell adhesion

signal transduction [inference]

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

calcium-mediated signaling [inference]

regulation of cardiac muscle contraction by calcium ion signaling

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process

small molecule metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

carbohydrate derivative metabolic process [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

protein localization to plasma membrane

transmembrane transport

monoatomic ion transmembrane transport [inference]

establishment or maintenance of transmembrane electrochemical gradient

monoatomic cation transmembrane transport [inference]

sodium ion transmembrane transport [inference]

sodium ion export across plasma membrane

potassium ion transmembrane transport [inference]

potassium ion import across plasma membrane

proton transmembrane transport

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

potassium ion import across plasma membrane

export across plasma membrane [inference]

sodium ion export across plasma membrane

export from cell [inference]

export across plasma membrane [inference]

sodium ion export across plasma membrane

multicellular organismal process [inference]

system process [inference]

muscle system process [inference]

muscle contraction [inference]

striated muscle contraction [inference]

cardiac muscle contraction

relaxation of muscle [inference]

relaxation of cardiac muscle

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

monoatomic cation homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis

potassium ion homeostasis [inference]

intracellular potassium ion homeostasis

sodium ion homeostasis [inference]

intracellular sodium ion homeostasis

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

inorganic ion homeostasis [inference]

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis

potassium ion homeostasis [inference]

intracellular potassium ion homeostasis

sodium ion homeostasis [inference]

intracellular sodium ion homeostasis

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

immune response [inference]

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein localization to membrane [inference]

protein localization to plasma membrane

protein localization to cell periphery [inference]

protein localization to plasma membrane

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

metal ion transport [inference]

potassium ion transport [inference]

potassium ion transmembrane transport [inference]

potassium ion import across plasma membrane

sodium ion transport [inference]

sodium ion transmembrane transport [inference]

sodium ion export across plasma membrane

monoatomic cation transmembrane transport [inference]

sodium ion transmembrane transport [inference]

sodium ion export across plasma membrane

potassium ion transmembrane transport [inference]

potassium ion import across plasma membrane

proton transmembrane transport

monoatomic ion transmembrane transport [inference]

establishment or maintenance of transmembrane electrochemical gradient

monoatomic cation transmembrane transport [inference]

sodium ion transmembrane transport [inference]

sodium ion export across plasma membrane

potassium ion transmembrane transport [inference]

potassium ion import across plasma membrane

proton transmembrane transport

transmembrane transport

monoatomic ion transmembrane transport [inference]

establishment or maintenance of transmembrane electrochemical gradient

monoatomic cation transmembrane transport [inference]

sodium ion transmembrane transport [inference]

sodium ion export across plasma membrane

potassium ion transmembrane transport [inference]

potassium ion import across plasma membrane

proton transmembrane transport

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

potassium ion import across plasma membrane

export across plasma membrane [inference]

sodium ion export across plasma membrane

import into cell [inference]

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

potassium ion import across plasma membrane

export from cell [inference]

export across plasma membrane [inference]

sodium ion export across plasma membrane

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

protein localization to plasma membrane

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of transmembrane transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of monoatomic cation transmembrane transport [inference]

regulation of potassium ion transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

regulation of potassium ion import [inference]

positive regulation of potassium ion import across plasma membrane

regulation of sodium ion transmembrane transport [inference]

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of sodium ion export across plasma membrane [inference]

positive regulation of sodium ion export across plasma membrane

regulation of calcium ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of monoatomic ion transport [inference]

regulation of metal ion transport [inference]

regulation of sodium ion transport [inference]

positive regulation of sodium ion transport [inference]

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of sodium ion transmembrane transport [inference]

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of sodium ion export across plasma membrane [inference]

positive regulation of sodium ion export across plasma membrane

regulation of potassium ion transport [inference]

positive regulation of potassium ion transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

regulation of potassium ion transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

regulation of potassium ion import [inference]

positive regulation of potassium ion import across plasma membrane

regulation of calcium ion transport [inference]

regulation of calcium ion transmembrane transport

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of monoatomic cation transmembrane transport [inference]

regulation of potassium ion transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

regulation of potassium ion import [inference]

positive regulation of potassium ion import across plasma membrane

regulation of sodium ion transmembrane transport [inference]

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of sodium ion export across plasma membrane [inference]

positive regulation of sodium ion export across plasma membrane

regulation of calcium ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of monoatomic ion transport [inference]

positive regulation of sodium ion transport [inference]

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of potassium ion transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of monoatomic ion transport [inference]

positive regulation of sodium ion transport [inference]

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of potassium ion transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of monoatomic ion transport [inference]

positive regulation of sodium ion transport [inference]

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of potassium ion transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

calcium-mediated signaling [inference]

regulation of cardiac muscle contraction by calcium ion signaling

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of transmembrane transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of monoatomic cation transmembrane transport [inference]

regulation of potassium ion transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

regulation of potassium ion import [inference]

positive regulation of potassium ion import across plasma membrane

regulation of sodium ion transmembrane transport [inference]

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of sodium ion export across plasma membrane [inference]

positive regulation of sodium ion export across plasma membrane

regulation of calcium ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of cellular process [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of muscle system process [inference]

regulation of muscle contraction [inference]

regulation of striated muscle contraction [inference]

regulation of cardiac muscle contraction [inference]

regulation of cardiac muscle contraction by calcium ion signaling

regulation of blood circulation [inference]

regulation of heart contraction [inference]

regulation of cardiac muscle contraction [inference]

regulation of cardiac muscle contraction by calcium ion signaling

regulation of biological quality [inference]

regulation of protein stability [inference]

protein stabilization

regulation of membrane potential [inference]

membrane repolarization

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
sodium:potassium-exchanging ATPase complex	IDA	PMID PMID
sodium:potassium-exchanging ATPase complex	IGI	PMID
sodium:potassium-exchanging ATPase complex	IBA	GO_REF
sodium:potassium-exchanging ATPase complex	IEA	GO_REF GO_REF
intercalated disc	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

sodium:potassium-exchanging ATPase complex

transmembrane transporter complex [inference]

ATPase dependent transmembrane transport complex [inference]

cation-transporting ATPase complex [inference]

sodium:potassium-exchanging ATPase complex

transporter complex [inference]

transmembrane transporter complex [inference]

ATPase dependent transmembrane transport complex [inference]

cation-transporting ATPase complex [inference]

sodium:potassium-exchanging ATPase complex

cellular anatomical structure [inference]

membrane [inference]

organelle membrane

plasma membrane region [inference]

lateral plasma membrane

cell junction [inference]

anchoring junction [inference]

cell-cell junction [inference]

cell-cell contact zone [inference]

intercalated disc

T-tubule

cell projection [inference]

plasma membrane bounded cell projection [inference]

cilium [inference]

motile cilium [inference]

9+2 motile cilium [inference]

sperm flagellum

organelle [inference]

membrane-bounded organelle [inference]

cilium [inference]

motile cilium [inference]

9+2 motile cilium [inference]

sperm flagellum

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
ATPase activator activity	IDA	PMID
ATPase activator activity	IGI	PMID
ATPase activator activity	IBA	GO_REF
ATPase activator activity	IEA	GO_REF
P-type sodium:potassium-exchanging transporter activity	IDA	PMID

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

metal ion transmembrane transporter activity [inference]

potassium ion transmembrane transporter activity [inference]

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

sodium ion transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

active monoatomic ion transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

active transmembrane transporter activity [inference]

primary active transmembrane transporter activity [inference]

active monoatomic ion transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

ATPase-coupled transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type transmembrane transporter activity [inference]

P-type ion transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

kinase binding [inference]

protein kinase binding

ATPase binding

molecular adaptor activity [inference]

protein-macromolecule adaptor activity

molecular function regulator activity [inference]

molecular function activator activity [inference]

transporter regulator activity [inference]

transporter activator activity

ATP-dependent activity [inference]

ATPase-coupled transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type transmembrane transporter activity [inference]

P-type ion transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
158	N-linked (GlcNAc...) asparagine	UniProt
193	N-linked (GlcNAc...) asparagine	UniProt
265	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Ion homeostasis	Sus scrofa
Ion transport by P-type ATPases	Sus scrofa

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements