GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Apolipoprotein C-III

Summary

UniProt ID: P06759
Gene Symbol: Apoc3
Gene ID
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: P06759
Re-Glyco: P06759

Annotation

Keyword: Chylomicron Lipid degradation Lipid transport Oxidation Reference proteome Secreted Sialic acid Signal VLDL

Gene Ontology (GO)

Displaying entries **1 - 5** of 43 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
triglyceride metabolic process	ISO	GO_REF
triglyceride mobilization	ISO	GO_REF
lipid transport	ISO	GO_REF
lipid transport	TAS	PMID
lipid transport	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

metabolic process [inference]

catabolic process [inference]

lipid catabolic process [inference]

glycerolipid catabolic process [inference]

acylglycerol catabolic process [inference]

triglyceride catabolic process

macromolecule metabolic process [inference]

protein metabolic process [inference]

lipoprotein metabolic process

primary metabolic process [inference]

lipid metabolic process [inference]

neutral lipid metabolic process [inference]

acylglycerol metabolic process [inference]

triglyceride metabolic process

acylglycerol catabolic process [inference]

triglyceride catabolic process

neutral lipid catabolic process [inference]

acylglycerol catabolic process [inference]

triglyceride catabolic process

steroid metabolic process [inference]

sterol metabolic process [inference]

cholesterol metabolic process

lipid catabolic process [inference]

glycerolipid catabolic process [inference]

acylglycerol catabolic process [inference]

triglyceride catabolic process

glycerolipid metabolic process [inference]

acylglycerol metabolic process [inference]

triglyceride metabolic process

acylglycerol catabolic process [inference]

triglyceride catabolic process

glycerolipid catabolic process [inference]

acylglycerol catabolic process [inference]

triglyceride catabolic process

protein metabolic process [inference]

lipoprotein metabolic process

small molecule metabolic process [inference]

alcohol metabolic process [inference]

secondary alcohol metabolic process [inference]

cholesterol metabolic process

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular component organization or biogenesis [inference]

cellular component organization [inference]

protein-containing complex organization [inference]

protein-containing complex remodeling [inference]

protein-lipid complex remodeling [inference]

plasma lipoprotein particle remodeling [inference]

high-density lipoprotein particle remodeling

protein-lipid complex organization [inference]

protein-lipid complex remodeling [inference]

plasma lipoprotein particle remodeling [inference]

high-density lipoprotein particle remodeling

plasma lipoprotein particle organization [inference]

plasma lipoprotein particle remodeling [inference]

high-density lipoprotein particle remodeling

multicellular organismal process [inference]

plasma lipoprotein particle clearance [inference]

triglyceride-rich lipoprotein particle clearance [inference]

chylomicron remnant clearance

plasma lipoprotein particle organization [inference]

plasma lipoprotein particle remodeling [inference]

high-density lipoprotein particle remodeling

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular glucose homeostasis [inference]

cellular response to glucose stimulus

chemical homeostasis [inference]

carbohydrate homeostasis [inference]

glucose homeostasis [inference]

intracellular glucose homeostasis [inference]

cellular response to glucose stimulus

intracellular chemical homeostasis [inference]

intracellular glucose homeostasis [inference]

cellular response to glucose stimulus

lipid homeostasis [inference]

acylglycerol homeostasis [inference]

triglyceride homeostasis

sterol homeostasis [inference]

cholesterol homeostasis

response to stimulus [inference]

response to endogenous stimulus [inference]

response to hormone [inference]

response to peptide hormone

response to nutrient levels [inference]

response to nutrient

response to vitamin [inference]

response to vitamin A

response to chemical [inference]

response to nutrient

response to vitamin [inference]

response to vitamin A

response to xenobiotic stimulus

response to hormone [inference]

response to peptide hormone

response to lipid [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

response to nitrogen compound [inference]

response to peptide hormone

response to oxygen-containing compound [inference]

response to carbohydrate [inference]

response to monosaccharide [inference]

response to hexose [inference]

response to glucose [inference]

cellular response to glucose stimulus

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to oxygen-containing compound [inference]

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

lipoprotein transport

lipoprotein localization [inference]

lipoprotein transport

establishment of localization [inference]

transport [inference]

lipid transport

phospholipid transport [inference]

phospholipid efflux

sterol transport [inference]

cholesterol transport [inference]

cholesterol efflux

protein transport [inference]

lipoprotein transport

organophosphate ester transport [inference]

phospholipid transport [inference]

phospholipid efflux

organic hydroxy compound transport [inference]

sterol transport [inference]

cholesterol transport [inference]

cholesterol efflux

establishment of protein localization [inference]

protein transport [inference]

lipoprotein transport

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of small GTPase mediated signal transduction [inference]

regulation of Rho protein signal transduction [inference]

regulation of Cdc42 protein signal transduction

regulation of localization [inference]

regulation of transport [inference]

regulation of lipid transport [inference]

negative regulation of lipid transport [inference]

negative regulation of sterol transport [inference]

negative regulation of cholesterol transport [inference]

negative regulation of cholesterol import

regulation of sterol transport [inference]

negative regulation of sterol transport [inference]

negative regulation of cholesterol transport [inference]

negative regulation of cholesterol import

regulation of cholesterol transport [inference]

negative regulation of cholesterol transport [inference]

negative regulation of cholesterol import

regulation of cholesterol import [inference]

negative regulation of cholesterol import

negative regulation of transport [inference]

negative regulation of lipid transport [inference]

negative regulation of sterol transport [inference]

negative regulation of cholesterol transport [inference]

negative regulation of cholesterol import

negative regulation of endocytosis [inference]

negative regulation of receptor-mediated endocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

negative regulation of endocytosis [inference]

negative regulation of receptor-mediated endocytosis

regulation of receptor-mediated endocytosis [inference]

negative regulation of receptor-mediated endocytosis

regulation of lipid localization [inference]

regulation of lipid transport [inference]

negative regulation of lipid transport [inference]

negative regulation of sterol transport [inference]

negative regulation of cholesterol transport [inference]

negative regulation of cholesterol import

regulation of sterol transport [inference]

negative regulation of sterol transport [inference]

negative regulation of cholesterol transport [inference]

negative regulation of cholesterol import

regulation of cholesterol transport [inference]

negative regulation of cholesterol transport [inference]

negative regulation of cholesterol import

regulation of cholesterol import [inference]

negative regulation of cholesterol import

negative regulation of lipid localization [inference]

negative regulation of lipid transport [inference]

negative regulation of sterol transport [inference]

negative regulation of cholesterol transport [inference]

negative regulation of cholesterol import

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of lipid metabolic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of triglyceride metabolic process [inference]

positive regulation of triglyceride biosynthetic process

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of lipid biosynthetic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of triglyceride catabolic process

negative regulation of lipid metabolic process

negative regulation of fatty acid metabolic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of lipid catabolic process

negative regulation of triglyceride catabolic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of triglyceride metabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of small molecule metabolic process [inference]

negative regulation of fatty acid metabolic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of cellular respiration [inference]

negative regulation of oxidative phosphorylation

negative regulation of cellular component organization [inference]

negative regulation of very-low-density lipoprotein particle remodeling

negative regulation of endocytosis [inference]

negative regulation of receptor-mediated endocytosis

negative regulation of transport [inference]

negative regulation of lipid transport [inference]

negative regulation of sterol transport [inference]

negative regulation of cholesterol transport [inference]

negative regulation of cholesterol import

negative regulation of endocytosis [inference]

negative regulation of receptor-mediated endocytosis

negative regulation of multicellular organismal process [inference]

negative regulation of very-low-density lipoprotein particle remodeling

negative regulation of lipoprotein particle clearance [inference]

negative regulation of lipid localization [inference]

negative regulation of lipid transport [inference]

negative regulation of sterol transport [inference]

negative regulation of cholesterol transport [inference]

negative regulation of cholesterol import

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of small GTPase mediated signal transduction [inference]

regulation of Rho protein signal transduction [inference]

regulation of Cdc42 protein signal transduction

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of small GTPase mediated signal transduction [inference]

regulation of Rho protein signal transduction [inference]

regulation of Cdc42 protein signal transduction

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of lipid biosynthetic process [inference]

negative regulation of fatty acid biosynthetic process

positive regulation of biosynthetic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

regulation of lipid biosynthetic process [inference]

regulation of triglyceride biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

regulation of fatty acid biosynthetic process [inference]

negative regulation of fatty acid biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of lipid biosynthetic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of triglyceride catabolic process

negative regulation of lipid metabolic process

negative regulation of fatty acid metabolic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of lipid catabolic process

negative regulation of triglyceride catabolic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of triglyceride metabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of small molecule metabolic process [inference]

negative regulation of fatty acid metabolic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of cellular respiration [inference]

negative regulation of oxidative phosphorylation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of lipid metabolic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of triglyceride metabolic process [inference]

positive regulation of triglyceride biosynthetic process

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of triglyceride catabolic process

regulation of lipid catabolic process [inference]

regulation of triglyceride catabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of lipid catabolic process

negative regulation of triglyceride catabolic process

regulation of ketone metabolic process [inference]

regulation of fatty acid metabolic process [inference]

regulation of fatty acid biosynthetic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of fatty acid metabolic process [inference]

negative regulation of fatty acid biosynthetic process

regulation of generation of precursor metabolites and energy [inference]

regulation of cellular respiration [inference]

negative regulation of cellular respiration [inference]

negative regulation of oxidative phosphorylation

regulation of aerobic respiration [inference]

regulation of oxidative phosphorylation [inference]

negative regulation of oxidative phosphorylation

regulation of small molecule metabolic process [inference]

regulation of fatty acid metabolic process [inference]

regulation of fatty acid biosynthetic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of fatty acid metabolic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of small molecule metabolic process [inference]

negative regulation of fatty acid metabolic process [inference]

negative regulation of fatty acid biosynthetic process

regulation of primary metabolic process [inference]

regulation of lipid metabolic process [inference]

regulation of fatty acid metabolic process [inference]

regulation of fatty acid biosynthetic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of fatty acid metabolic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of lipid metabolic process

negative regulation of fatty acid metabolic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of lipid catabolic process

negative regulation of triglyceride catabolic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of triglyceride metabolic process [inference]

negative regulation of triglyceride catabolic process

positive regulation of lipid metabolic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of triglyceride metabolic process [inference]

positive regulation of triglyceride biosynthetic process

regulation of lipid biosynthetic process [inference]

regulation of triglyceride biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

regulation of fatty acid biosynthetic process [inference]

negative regulation of fatty acid biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of fatty acid biosynthetic process

regulation of lipid catabolic process [inference]

regulation of triglyceride catabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of lipid catabolic process

negative regulation of triglyceride catabolic process

regulation of triglyceride metabolic process [inference]

regulation of triglyceride biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

regulation of triglyceride catabolic process [inference]

negative regulation of triglyceride catabolic process

positive regulation of triglyceride metabolic process [inference]

positive regulation of triglyceride biosynthetic process

negative regulation of triglyceride metabolic process [inference]

negative regulation of triglyceride catabolic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of lipid metabolic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of triglyceride metabolic process [inference]

positive regulation of triglyceride biosynthetic process

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of lipid biosynthetic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of triglyceride catabolic process

negative regulation of lipid metabolic process

negative regulation of fatty acid metabolic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of lipid catabolic process

negative regulation of triglyceride catabolic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of triglyceride metabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of small molecule metabolic process [inference]

negative regulation of fatty acid metabolic process [inference]

negative regulation of fatty acid biosynthetic process

negative regulation of cellular respiration [inference]

negative regulation of oxidative phosphorylation

negative regulation of cellular component organization [inference]

negative regulation of very-low-density lipoprotein particle remodeling

negative regulation of endocytosis [inference]

negative regulation of receptor-mediated endocytosis

regulation of cellular component organization [inference]

regulation of very-low-density lipoprotein particle remodeling [inference]

negative regulation of very-low-density lipoprotein particle remodeling

regulation of endocytosis [inference]

negative regulation of endocytosis [inference]

negative regulation of receptor-mediated endocytosis

regulation of receptor-mediated endocytosis [inference]

negative regulation of receptor-mediated endocytosis

negative regulation of cellular component organization [inference]

negative regulation of very-low-density lipoprotein particle remodeling

negative regulation of endocytosis [inference]

negative regulation of receptor-mediated endocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

negative regulation of endocytosis [inference]

negative regulation of receptor-mediated endocytosis

regulation of receptor-mediated endocytosis [inference]

negative regulation of receptor-mediated endocytosis

regulation of multicellular organismal process [inference]

regulation of very-low-density lipoprotein particle remodeling [inference]

negative regulation of very-low-density lipoprotein particle remodeling

regulation of lipoprotein particle clearance [inference]

regulation of very-low-density lipoprotein particle clearance [inference]

negative regulation of very-low-density lipoprotein particle clearance

regulation of high-density lipoprotein particle clearance [inference]

negative regulation of high-density lipoprotein particle clearance

negative regulation of lipoprotein particle clearance [inference]

regulation of low-density lipoprotein particle clearance [inference]

negative regulation of low-density lipoprotein particle clearance

negative regulation of multicellular organismal process [inference]

negative regulation of very-low-density lipoprotein particle remodeling

negative regulation of lipoprotein particle clearance [inference]

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
very-low-density lipoprotein particle	ISO	GO_REF
very-low-density lipoprotein particle	IBA	GO_REF
intermediate-density lipoprotein particle	ISO	GO_REF
intermediate-density lipoprotein particle	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

protein-lipid complex [inference]

lipoprotein particle [inference]

plasma lipoprotein particle [inference]

high-density lipoprotein particle [inference]

spherical high-density lipoprotein particle

triglyceride-rich plasma lipoprotein particle [inference]

chylomicron

extracellular protein-containing complex [inference]

plasma lipoprotein particle [inference]

high-density lipoprotein particle [inference]

spherical high-density lipoprotein particle

triglyceride-rich plasma lipoprotein particle [inference]

chylomicron

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
lipid carrier activity	TAS	PMID
phospholipid binding	ISO	GO_REF
phospholipid binding	IBA	GO_REF
lipase inhibitor activity	ISO	GO_REF
lipase inhibitor activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

lipoprotein particle receptor binding [inference]

high-density lipoprotein particle receptor binding

lipid binding [inference]

phospholipid binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

lipase inhibitor activity

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

lipase inhibitor activity

molecular carrier activity [inference]

lipid carrier activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQPRMLLIVALVALLASARADEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVASRGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
96	O-linked (GalNAc...) threonine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Chylomicron assembly	Rattus norvegicus
Chylomicron remodeling	Rattus norvegicus
HDL remodeling	Rattus norvegicus
Retinoid metabolism and transport	Rattus norvegicus

Disease

Displaying **all 3** entries
DO ID	Disease Name	Source
DOID:1459	hypothyroidism	Alliance of Genome Resources
DOID:7998	hyperthyroidism	Alliance of Genome Resources
DOID:9744	type 1 diabetes mellitus	Alliance of Genome Resources

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026