GlyCosmos Portal

Submissions

Neuromodulin

Summary

UniProt ID: P06837
Gene Symbol: Gap43 Basp2
Gene ID: 14432
Organism: Mus musculus (house mouse)

External Links

GlyGen: P06837
PubChem: P06837
RaftProt: P06837
O-GlcNAcAtlas: P06837
Re-Glyco: P06837

Annotation

Keyword: 3D-structure Calmodulin-binding Cell membrane Cell projection Cytoplasm Developmental protein Differentiation Direct protein sequencing Growth regulation Neurogenesis Palmitate Phosphoprotein Reference proteome Synapse

Gene Ontology (GO)

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
axon guidance	IMP	PMID
glial cell differentiation	IMP	PMID
response to auditory stimulus	IEA	GO_REF
axon choice point recognition	IMP	PMID
axon choice point recognition	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell recognition [inference]

neuron recognition [inference]

axon choice point recognition

cellular developmental process [inference]

cell differentiation [inference]

glial cell differentiation

cell fate commitment

cellular response to stimulus [inference]

cellular response to stress [inference]

neuron projection regeneration [inference]

axon regeneration

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

neuron projection regeneration [inference]

axon regeneration

axon development [inference]

axon regeneration

neuron projection guidance [inference]

axon guidance

developmental process [inference]

anatomical structure development [inference]

regeneration [inference]

neuron projection regeneration [inference]

axon regeneration

tissue regeneration

animal gross anatomical part developmental process [inference]

tissue regeneration

cellular developmental process [inference]

cell differentiation [inference]

glial cell differentiation

cell fate commitment

growth [inference]

developmental growth [inference]

tissue regeneration

response to stimulus [inference]

response to stress [inference]

response to wounding [inference]

response to axon injury [inference]

axon regeneration

cellular response to stress [inference]

neuron projection regeneration [inference]

axon regeneration

response to external stimulus [inference]

response to mechanical stimulus [inference]

response to auditory stimulus

response to abiotic stimulus [inference]

response to mechanical stimulus [inference]

response to auditory stimulus

cellular response to stimulus [inference]

cellular response to stress [inference]

neuron projection regeneration [inference]

axon regeneration

biological regulation [inference]

regulation of biological process [inference]

regulation of growth

regulation of cellular process [inference]

regulation of cellular component biogenesis [inference]

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

regulation of filopodium assembly

regulation of organelle assembly [inference]

regulation of postsynaptic specialization assembly

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

regulation of filopodium assembly

regulation of plasma membrane bounded cell projection organization [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

regulation of filopodium assembly

regulation of organelle organization [inference]

regulation of organelle assembly [inference]

regulation of postsynaptic specialization assembly

Displaying entries **1 - 5** of 26 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	ISS	GO_REF
cytoplasm	ISO	GO_REF
cytoplasm	IDA	PMID
cytoplasm	IBA	GO_REF
cytoplasm	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

membrane [inference]

plasma membrane

plasma membrane region [inference]

cell projection membrane [inference]

filopodium membrane

cell junction [inference]

synapse [inference]

GABA-ergic synapse

growth cone membrane

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

perikaryon

organelle [inference]

postsynaptic specialization [inference]

postsynaptic density

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
phosphatidylserine binding	ISO	GO_REF
phosphatidylserine binding	IBA	GO_REF
phosphatidylserine binding	IEA	GO_REF
calmodulin binding	IBA	GO_REF
lysophosphatidic acid binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

calmodulin binding

lipid binding [inference]

phospholipid binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

modified amino acid binding [inference]

phosphatidylserine binding

carbohydrate derivative binding [inference]

lysophosphatidic acid binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLCCMRRTKQVEKNDEDQKIEQDGVKPEDKAHKAATKIQASFRGHITRKKLKGEKKGDAPAAEAEAKEKDDAPVADGVEKKEGDGSATTDAAPATSPKAEEPSKAGDAPSEEKKGEGDAAPSEEKAGSAETESAAKATTDNSPSSKAEDGPAKEEPKQADVPAAVTDAAATTPAAEDAATKAAQPPTETAESSQAEEEKDAVDEAKPKESARQDEGKEDPEADQEHA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites