GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Transthyretin

Summary

UniProt ID: P07309
Gene Symbol: Ttr
Gene ID: 22139
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0003303
GlyGen: P07309
PubChem: P07309
Re-Glyco: P07309

Annotation

Keyword: 3D-structure Gamma-carboxyglutamic acid Glycoprotein Phosphoprotein Reference proteome Secreted Signal Sulfation Thyroid hormone Transport

Gene Ontology (GO)

Displaying **all 2** entries
GO Term	Evidence Code	Reference
retinoid metabolic process	IMP	PMID
purine nucleobase metabolic process	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleobase metabolic process [inference]

purine nucleobase metabolic process

lipid metabolic process [inference]

isoprenoid metabolic process [inference]

terpenoid metabolic process [inference]

diterpenoid metabolic process [inference]

retinoid metabolic process

small molecule metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleobase metabolic process [inference]

purine nucleobase metabolic process

purine-containing compound metabolic process [inference]

purine nucleobase metabolic process

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISO	GO_REF
extracellular region	IDA	PMID
extracellular region	IEA	GO_REF GO_REF
obsolete extracellular space
protein-containing complex	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex

cellular anatomical structure [inference]

extracellular region

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
hormone activity
hormone binding	ISO	GO_REF
hormone binding	IEA	GO_REF
identical protein binding	ISO	GO_REF
identical protein binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

identical protein binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

hormone activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

hormone activity

molecular sequestering activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MASLRLFLLCLAGLVFVSEAGPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
118	N-linked (GlcNAc...) asparagine	17330941	G80920RR	GlycoProtDB UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Neutrophil degranulation	Mus musculus
Retinoid metabolism and transport	Mus musculus
The canonical retinoid cycle in rods (twilight vision)	Mus musculus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:0050638	hereditary systemic amyloidosis 1	Alliance of Genome Resources

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026