GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Alpha-1-antitrypsin 1-1

Summary

UniProt ID: P07758
Gene Symbol: Dom1 Serpina1a Spi1-1
Gene ID: 20700
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0003305
GlyGen: P07758
O-GlcNAcAtlas: P07758
Re-Glyco: P07758

Annotation

Keyword: Acute phase Glycoprotein Reference proteome Secreted Serine protease inhibitor Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
protein N-linked glycosylation	IDA	PMID
acute-phase response
response to lead ion	ISO	GO_REF
response to methanol	ISO	GO_REF
response to cytokine	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

primary metabolic process [inference]

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response [inference]

acute inflammatory response [inference]

acute-phase response

response to endogenous stimulus [inference]

response to hormone [inference]

response to peptide hormone

response to chemical [inference]

response to hormone [inference]

response to peptide hormone

response to metal ion [inference]

response to lead ion

response to peptide [inference]

response to cytokine

response to nitrogen compound [inference]

response to peptide hormone

response to oxygen-containing compound [inference]

response to alcohol [inference]

response to methanol

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISO	GO_REF GO_REF
extracellular region	IDA	PMID
extracellular region	IEA	GO_REF
obsolete extracellular space
endoplasmic reticulum	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

external encapsulating structure [inference]

extracellular matrix

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
protease binding	ISO	GO_REF
endopeptidase inhibitor activity	ISO	GO_REF
serine-type endopeptidase inhibitor activity	ISO	GO_REF
serine-type endopeptidase inhibitor activity	IBA	GO_REF
serine-type endopeptidase inhibitor activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

protease binding

identical protein binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity

serine-type endopeptidase inhibitor activity

peptidase regulator activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity

serine-type endopeptidase inhibitor activity

endopeptidase regulator activity [inference]

endopeptidase inhibitor activity

serine-type endopeptidase inhibitor activity

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity

serine-type endopeptidase inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MTPSISWGLLLLAGLCCLVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLHVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFLGKVVDPTHK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
64	N-linked (GlcNAc...) asparagine	17330941		GlycoProtDB UniProt GlyGen
83			G49108TO	GlyGen
101	N-linked (GlcNAc...) asparagine	17330941	G60033FS	GlycoProtDB UniProt GlyGen
265	N-linked (GlcNAc...) asparagine			UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026