GlyCosmos Portal

Submissions

Inhibin alpha chain

Summary

UniProt ID

P07994

Gene Symbol

INHA

Gene ID

[281254]

Organism

Bos taurus (domestic cattle)

External Links

PubChem: P07994
Re-Glyco: P07994

Annotation

Keyword: Cleavage on pair of basic residues Direct protein sequencing Disulfide bond Glycoprotein Growth factor Hormone Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cell surface receptor protein serine/threonine kinase signaling pathway	IBA	GO_REF
regulation of cell population proliferation	IEA	GO_REF
hemoglobin biosynthetic process	ISS	GO_REF
hemoglobin biosynthetic process	IEA	GO_REF
regulation of follicle-stimulating hormone secretion	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

hemoglobin biosynthetic process

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

hemoglobin biosynthetic process

protein metabolic process [inference]

hemoglobin metabolic process [inference]

hemoglobin biosynthetic process

primary metabolic process [inference]

protein metabolic process [inference]

hemoglobin metabolic process [inference]

hemoglobin biosynthetic process

developmental process [inference]

anatomical structure development [inference]

system development

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of hormone secretion [inference]

regulation of gonadotropin secretion [inference]

regulation of follicle-stimulating hormone secretion

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

regulation of gonadotropin secretion [inference]

regulation of follicle-stimulating hormone secretion

negative regulation of biological process [inference]

negative regulation of multicellular organismal process

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway

regulation of cell communication [inference]

regulation of hormone secretion [inference]

regulation of gonadotropin secretion [inference]

regulation of follicle-stimulating hormone secretion

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

regulation of gonadotropin secretion [inference]

regulation of follicle-stimulating hormone secretion

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of endocrine process [inference]

regulation of gonadotropin secretion [inference]

regulation of follicle-stimulating hormone secretion

negative regulation of multicellular organismal process

regulation of biological quality [inference]

regulation of hormone levels [inference]

regulation of hormone secretion [inference]

regulation of gonadotropin secretion [inference]

regulation of follicle-stimulating hormone secretion

Displaying **all 3** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
inhibin-betaglycan-ActRII complex	IEA	GO_REF
inhibin A complex	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

inhibin-betaglycan-ActRII complex

extracellular protein-containing complex [inference]

inhibin complex [inference]

inhibin A complex

Displaying **all 3** entries
GO Term	Evidence Code	Reference
cytokine activity	IBA	GO_REF
hormone activity
growth factor activity	IEA	GO_REF

GO Hierarchy

molecular function

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MWLQLLLLLLAPQGGHGCHGLELDRELVLAKVRALFLDALGPPPVTGEGGDPGVRRLHRRHAVGGFMRRGSEPEDQDVSQAILFPAAGASCGDEPDAGEAEEGLFTYVFQPSQHTRSRQVTSAQLWFHTGLDRQETAAANSSEPLLGLLVLTSGGPMPVPMSLGQAPPRWAVLHLATSAFPLLTHPVLALLLRCPLCSCSTRPEATPFLVAHTRAKPPSGGERARRSTPPLPWPWSPAALRLLQRPPEEPAAHADCHRAALNISFQELGWDRWIVHPPSFIFYYCHGGCGLSPPQDLPLPVPGVPPTPVQPLSLVPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYEMVPNLLTQHCACI

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
140	N-linked (GlcNAc...) asparagine			UniProt
262	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Glycoprotein hormones	Bos taurus
Signaling by Activin	Bos taurus
Signaling by BMP	Bos taurus
TGFBR3 regulates activin signaling	Bos taurus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements