GlyCosmos Portal

Submissions

Beta-1,4-galactosyltransferase 1

Summary

UniProt ID

P08037

Gene Symbol

B4GALT1
GALT
GGTB2

Gene ID

281781

Organism

Bos taurus (domestic cattle)

External Links

PubChem: P08037
Re-Glyco: P08037

Annotation

Keyword: 3D-structure Alternative initiation Cell membrane Cell projection Direct protein sequencing Disulfide bond Glycoprotein Glycosyltransferase Golgi apparatus Lipid metabolism Manganese Metal-binding Reference proteome Secreted Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 27 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
epithelial cell development
acute inflammatory response
lactose biosynthetic process	IDA	PMID
galactose metabolic process
protein N-linked glycosylation	ISS	GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte migration [inference]

mononuclear cell migration [inference]

macrophage migration

myeloid leukocyte migration [inference]

macrophage migration

cellular process [inference]

cell adhesion

cell recognition [inference]

cell-cell recognition [inference]

sperm-egg recognition [inference]

binding of sperm to zona pellucida

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

carbohydrate biosynthetic process [inference]

oligosaccharide biosynthetic process

disaccharide biosynthetic process [inference]

lactose biosynthetic process

carbohydrate derivative biosynthetic process

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

primary metabolic process [inference]

carbohydrate metabolic process [inference]

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

galactose metabolic process

oligosaccharide metabolic process [inference]

disaccharide metabolic process [inference]

lactose metabolic process [inference]

lactose biosynthetic process

disaccharide biosynthetic process [inference]

lactose biosynthetic process

oligosaccharide biosynthetic process

disaccharide biosynthetic process [inference]

lactose biosynthetic process

carbohydrate biosynthetic process [inference]

oligosaccharide biosynthetic process

disaccharide biosynthetic process [inference]

lactose biosynthetic process

lipid metabolic process

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

small molecule metabolic process [inference]

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

galactose metabolic process

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

carbohydrate derivative biosynthetic process

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

cell population proliferation [inference]

epithelial cell proliferation

cellular developmental process [inference]

cell development [inference]

epithelial cell development

cell motility [inference]

cell migration [inference]

leukocyte migration [inference]

mononuclear cell migration [inference]

macrophage migration

myeloid leukocyte migration [inference]

macrophage migration

cellular component organization or biogenesis [inference]

cellular component organization [inference]

extracellular structure organization [inference]

extracellular matrix organization

external encapsulating structure organization [inference]

extracellular matrix organization

reproductive process [inference]

developmental process involved in reproduction [inference]

development of secondary sexual characteristics

multicellular organismal reproductive process [inference]

penetration of zona pellucida

multicellular organismal process [inference]

multi-multicellular organism process [inference]

penetration of zona pellucida

developmental process [inference]

developmental process involved in reproduction [inference]

development of secondary sexual characteristics

anatomical structure formation involved in morphogenesis [inference]

angiogenesis [inference]

angiogenesis involved in wound healing

anatomical structure development [inference]

cell development [inference]

epithelial cell development

cellular developmental process [inference]

cell development [inference]

epithelial cell development

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response [inference]

acute inflammatory response

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of epithelial cell proliferation [inference]

positive regulation of epithelial cell proliferation involved in wound healing

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation

regulation of cellular process [inference]

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of epithelial cell proliferation [inference]

positive regulation of epithelial cell proliferation involved in wound healing

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation

regulation of epithelial cell proliferation [inference]

positive regulation of epithelial cell proliferation [inference]

positive regulation of epithelial cell proliferation involved in wound healing

negative regulation of epithelial cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of epithelial cell proliferation [inference]

positive regulation of epithelial cell proliferation involved in wound healing

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation

regulation of reproductive process [inference]

regulation of acrosome reaction

regulation of biological quality [inference]

regulation of circulating fibrinogen levels [inference]

positive regulation of circulating fibrinogen levels

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi trans cisterna	ISS	GO_REF
Golgi trans cisterna	IEA	GO_REF
obsolete extracellular space
Golgi apparatus	ISS	GO_REF
Golgi apparatus	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

Golgi cisterna membrane

plasma membrane region [inference]

basolateral plasma membrane

cell projection membrane [inference]

brush border membrane

cell junction [inference]

anchoring junction [inference]

cell-cell junction [inference]

desmosome

organelle subcompartment [inference]

Golgi apparatus subcompartment [inference]

Golgi cisterna [inference]

Golgi trans cisterna

cell projection [inference]

plasma membrane bounded cell projection [inference]

actin-based cell projection [inference]

filopodium

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity	ISS	GO_REF
beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity	EXP	PMID
beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity	IDA	PMID PMID
beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity	IBA	GO_REF
beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

UDP-glycosyltransferase activity [inference]

UDP-galactosyltransferase activity

hexosyltransferase activity [inference]

galactosyltransferase activity [inference]

UDP-galactosyltransferase activity

binding [inference]

protein binding [inference]

cytoskeletal protein binding [inference]

tubulin binding [inference]

identical protein binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

manganese ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKFREPLLGGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLRRLPQLVGVHPPLQGSSHGAAAIGQPSGELRLRGVAPPPPLQNSSKPRSRAPSNLDAYSHPGPGPGPGSNLTSAPVPSTTTRSLTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
90	N-linked (GlcNAc...) asparagine	2117606		UniProt
117	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Interaction With Cumulus Cells And The Zona Pellucida	Bos taurus
Keratan sulfate biosynthesis	Bos taurus
Lactose synthesis	Bos taurus
N-Glycan antennae elongation	Bos taurus
Neutrophil degranulation	Bos taurus