GlyCosmos Portal

Submissions

Early growth response protein 1

Summary

UniProt ID: P08046
Gene Symbol: Egr1 Egr-1 Krox-24
Gene ID: 13653
Organism: Mus musculus (house mouse)

External Links

GlyGen: P08046
PubChem: P08046
The O-GlcNAc Database: P08046
O-GlcNAcAtlas: P08046
Re-Glyco: P08046

Annotation

Keyword: 3D-structure Activator Biological rhythms Cytoplasm DNA-binding Isopeptide bond Nucleus Reference proteome Repeat Transcription regulation Ubl conjugation Zinc-finger

Gene Ontology (GO)

Displaying entries **1 - 5** of 69 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	IDA	PMID
response to hypoxia	IMP	PMID
response to ischemia	ISO	GO_REF
response to ischemia	IMP	PMID
response to ischemia	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation

T cell activation [inference]

T cell differentiation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation

T cell activation [inference]

T cell differentiation

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

BMP signaling pathway

cytokine-mediated signaling pathway [inference]

interleukin-1-mediated signaling pathway

cell population proliferation [inference]

cell proliferation involved in kidney development [inference]

glomerular mesangial cell proliferation

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation [inference]

T cell differentiation

skeletal muscle cell differentiation

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to heparin

cellular response to oxygen-containing compound [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

chromatin organization [inference]

chromatin remodeling [inference]

epigenetic regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling [inference]

positive regulation of gene expression via chromosomal CpG island demethylation

reproductive process [inference]

multicellular organismal reproductive process [inference]

ovulation cycle [inference]

estrous cycle

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation

T cell activation [inference]

T cell differentiation

system process [inference]

nervous system process [inference]

cognition [inference]

learning or memory

memory [inference]

long-term memory

behavior [inference]

learning or memory

memory [inference]

long-term memory

rhythmic behavior [inference]

circadian behavior [inference]

locomotor rhythm

locomotory behavior [inference]

locomotor rhythm

multicellular organismal-level homeostasis [inference]

temperature homeostasis [inference]

circadian temperature homeostasis

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation [inference]

T cell differentiation

skeletal muscle cell differentiation

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

temperature homeostasis [inference]

circadian temperature homeostasis

rhythmic process [inference]

circadian rhythm [inference]

circadian regulation of gene expression

circadian behavior [inference]

locomotor rhythm

circadian temperature homeostasis

ovulation cycle [inference]

estrous cycle

response to stimulus [inference]

response to stress [inference]

response to abiotic stimulus [inference]

response to radiation [inference]

response to ionizing radiation [inference]

response to gamma radiation [inference]

cellular response to gamma radiation

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

cellular response to radiation [inference]

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

response to oxygen levels [inference]

response to decreased oxygen levels [inference]

response to hypoxia

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

response to endogenous stimulus [inference]

response to hormone [inference]

response to peptide hormone [inference]

response to insulin

response to chemical [inference]

response to hormone [inference]

response to peptide hormone [inference]

response to insulin

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to heparin

cellular response to oxygen-containing compound [inference]

response to peptide [inference]

response to cytokine [inference]

cellular response to cytokine stimulus [inference]

cellular response to interleukin-8

response to interleukin-8 [inference]

cellular response to interleukin-8

response to nitrogen compound [inference]

response to peptide hormone [inference]

response to insulin

response to heparin [inference]

cellular response to heparin

cellular response to nitrogen compound [inference]

cellular response to heparin

response to oxygen-containing compound [inference]

response to carbohydrate [inference]

response to monosaccharide [inference]

response to hexose [inference]

response to glucose

response to peptide hormone [inference]

response to insulin

response to heparin [inference]

cellular response to heparin

response to mycophenolic acid [inference]

cellular response to mycophenolic acid

cellular response to oxygen-containing compound [inference]

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to heparin

cellular response to oxygen-containing compound [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic plasticity [inference]

regulation of neuronal synaptic plasticity [inference]

regulation of long-term neuronal synaptic plasticity

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of smooth muscle cell migration [inference]

positive regulation of smooth muscle cell migration

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration

positive regulation of biological process [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of cell proliferation involved in kidney development [inference]

positive regulation of glomerular mesangial cell proliferation [inference]

positive regulation of glomerular metanephric mesangial cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling [inference]

positive regulation of gene expression via chromosomal CpG island demethylation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of hormone biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling [inference]

positive regulation of gene expression via chromosomal CpG island demethylation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

positive regulation of hormone metabolic process [inference]

positive regulation of hormone biosynthetic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

BMP signaling pathway

cytokine-mediated signaling pathway [inference]

interleukin-1-mediated signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic plasticity [inference]

regulation of neuronal synaptic plasticity [inference]

regulation of long-term neuronal synaptic plasticity

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling [inference]

positive regulation of gene expression via chromosomal CpG island demethylation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of hormone biosynthetic process

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of chemokine production [inference]

positive regulation of chemokine production

regulation of interleukin-1 production [inference]

regulation of interleukin-1 beta production [inference]

positive regulation of interleukin-1 beta production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling [inference]

positive regulation of gene expression via chromosomal CpG island demethylation

circadian regulation of gene expression

epigenetic regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling [inference]

positive regulation of gene expression via chromosomal CpG island demethylation

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling [inference]

positive regulation of gene expression via chromosomal CpG island demethylation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of ketone biosynthetic process [inference]

regulation of progesterone biosynthetic process

regulation of hormone biosynthetic process [inference]

regulation of lipid biosynthetic process [inference]

regulation of steroid biosynthetic process [inference]

regulation of progesterone biosynthetic process

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling [inference]

positive regulation of gene expression via chromosomal CpG island demethylation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of hormone biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling [inference]

positive regulation of gene expression via chromosomal CpG island demethylation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

positive regulation of hormone metabolic process [inference]

positive regulation of hormone biosynthetic process

regulation of ketone metabolic process [inference]

regulation of ketone biosynthetic process [inference]

regulation of progesterone biosynthetic process

regulation of hormone metabolic process [inference]

positive regulation of hormone metabolic process [inference]

positive regulation of hormone biosynthetic process

regulation of hormone biosynthetic process [inference]

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of chemokine production [inference]

positive regulation of chemokine production

regulation of interleukin-1 production [inference]

regulation of interleukin-1 beta production [inference]

positive regulation of interleukin-1 beta production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling [inference]

positive regulation of gene expression via chromosomal CpG island demethylation

circadian regulation of gene expression

epigenetic regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling [inference]

positive regulation of gene expression via chromosomal CpG island demethylation

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling [inference]

positive regulation of gene expression via chromosomal CpG island demethylation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling [inference]

positive regulation of gene expression via chromosomal CpG island demethylation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification

regulation of post-translational protein modification [inference]

positive regulation of post-translational protein modification

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein sumoylation

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of miRNA metabolic process [inference]

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of small molecule metabolic process [inference]

regulation of ketone biosynthetic process [inference]

regulation of progesterone biosynthetic process

regulation of primary metabolic process [inference]

regulation of lipid metabolic process [inference]

regulation of steroid metabolic process [inference]

regulation of steroid biosynthetic process [inference]

regulation of progesterone biosynthetic process

regulation of lipid biosynthetic process [inference]

regulation of steroid biosynthetic process [inference]

regulation of progesterone biosynthetic process

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of miRNA metabolic process [inference]

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification

regulation of post-translational protein modification [inference]

positive regulation of post-translational protein modification

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein sumoylation

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of cell proliferation involved in kidney development [inference]

positive regulation of glomerular mesangial cell proliferation [inference]

positive regulation of glomerular metanephric mesangial cell proliferation

regulation of smooth muscle cell proliferation [inference]

positive regulation of smooth muscle cell proliferation

regulation of glomerular mesangial cell proliferation [inference]

positive regulation of glomerular mesangial cell proliferation [inference]

positive regulation of glomerular metanephric mesangial cell proliferation

regulation of metanephric glomerular mesangial cell proliferation [inference]

positive regulation of glomerular metanephric mesangial cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

regulation of neuron apoptotic process

positive regulation of neuron apoptotic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of cell proliferation involved in kidney development [inference]

positive regulation of glomerular mesangial cell proliferation [inference]

positive regulation of glomerular metanephric mesangial cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling [inference]

positive regulation of gene expression via chromosomal CpG island demethylation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of hormone biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling [inference]

positive regulation of gene expression via chromosomal CpG island demethylation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

positive regulation of hormone metabolic process [inference]

positive regulation of hormone biosynthetic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of smooth muscle cell migration [inference]

positive regulation of smooth muscle cell migration

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of chemokine production [inference]

positive regulation of chemokine production

regulation of interleukin-1 production [inference]

regulation of interleukin-1 beta production [inference]

positive regulation of interleukin-1 beta production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of biological quality [inference]

regulation of hormone levels [inference]

regulation of hormone metabolic process [inference]

positive regulation of hormone metabolic process [inference]

positive regulation of hormone biosynthetic process

regulation of hormone biosynthetic process [inference]

regulation of synaptic plasticity [inference]

regulation of neuronal synaptic plasticity [inference]

regulation of long-term neuronal synaptic plasticity

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
chromatin	ISO	GO_REF
chromatin	IEA	GO_REF
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF GO_REF
nucleus	EXP	PMID PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying entries **1 - 5** of 44 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
transcription cis-regulatory region binding	ISO	GO_REF
transcription cis-regulatory region binding	IDA	PMID
transcription cis-regulatory region binding	IEA	GO_REF
RNA polymerase II transcription regulatory region sequence-specific DNA binding	ISO	GO_REF GO_REF
RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	PMID

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

transcription regulatory region nucleic acid binding [inference]

transcription cis-regulatory region binding

RNA polymerase II transcription regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

core promoter sequence-specific DNA binding [inference]

RNA polymerase II core promoter sequence-specific DNA binding

DNA binding

double-stranded DNA binding

sequence-specific double-stranded DNA binding

transcription cis-regulatory region binding

RNA polymerase II transcription regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

core promoter sequence-specific DNA binding [inference]

RNA polymerase II core promoter sequence-specific DNA binding

sequence-specific DNA binding

sequence-specific double-stranded DNA binding

transcription cis-regulatory region binding

RNA polymerase II transcription regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

core promoter sequence-specific DNA binding [inference]

RNA polymerase II core promoter sequence-specific DNA binding

chromatin binding [inference]

promoter-specific chromatin binding

protein binding [inference]

enzyme binding

histone acetyltransferase binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

transcription regulator activity [inference]

DNA-binding transcription factor activity

DNA-binding transcription factor activity, RNA polymerase II-specific

DNA-binding transcription activator activity, RNA polymerase II-specific

DNA-binding transcription activator activity [inference]

DNA-binding transcription activator activity, RNA polymerase II-specific

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGTPEGSGGNSSSSTSSGGGGGGGSNSGSSAFNPQGEPSEQPYEHLTTESFSDIALNNEKAMVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPTSSSSAPSPAASSSSSASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPATKGGFQVPMIPDYLFPQQQGDLSLGTPDQKPFQGLENRTQQPSLTPLSTIKAFATQSGSQDLKALNTTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVASPAASSLSSYPSPVATSYPSPATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQVSSFPSAGVSSSFSTSTGLSDMTATFSPRTIEIC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
116		21606357 22517741 22645316 29187734 34678516 35822049 36852467 40885482 40997131	G49108TO	GlyGen The O-GlcNAc Database
117		21606357 22517741 22645316 29187734 34678516 35822049 36852467 40885482 40997131	G49108TO	GlyGen The O-GlcNAc Database