GlyCosmos Portal

Submissions

Low affinity immunoglobulin gamma Fc region receptor II

Summary

UniProt ID: P08101
Gene Symbol: Fcgr2 Fcgr2b Ly-17
Gene ID: 14130
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB

GPDB0003308

GlyConnect

Low affinity immunoglobulin gamma Fc region receptor II

GlyGen

P08101

PubChem

P08101

RaftProt

P08101

Re-Glyco

P08101

Annotation

Keyword: Alternative splicing Cell membrane Cytoskeleton Direct protein sequencing Disulfide bond Glycoprotein IgG-binding protein Immunoglobulin domain Phosphoprotein Receptor Reference proteome Repeat Secreted Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 37 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
antibody-dependent cellular cytotoxicity	IBA	GO_REF
negative regulation of type I hypersensitivity	IMP	PMID
immune complex clearance	ISO	GO_REF
negative regulation of immunoglobulin production	IMP	PMID
negative regulation of inflammatory response to antigenic stimulus	IMP	PMID

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

immune complex clearance

leukocyte mediated immunity [inference]

leukocyte mediated cytotoxicity [inference]

antibody-dependent cellular cytotoxicity

myeloid leukocyte mediated immunity [inference]

type II hypersensitivity [inference]

type IIa hypersensitivity [inference]

antibody-dependent cellular cytotoxicity

lymphocyte mediated immunity [inference]

B cell mediated immunity [inference]

immunoglobulin mediated immune response

type II hypersensitivity [inference]

type IIa hypersensitivity [inference]

antibody-dependent cellular cytotoxicity

immune response [inference]

adaptive immune response [inference]

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

B cell mediated immunity [inference]

immunoglobulin mediated immune response

type II hypersensitivity [inference]

type IIa hypersensitivity [inference]

antibody-dependent cellular cytotoxicity

inflammatory response to antigenic stimulus [inference]

acute inflammatory response to antigenic stimulus [inference]

hypersensitivity [inference]

type II hypersensitivity [inference]

type IIa hypersensitivity [inference]

antibody-dependent cellular cytotoxicity

antigen processing and presentation [inference]

antigen processing and presentation of peptide or polysaccharide antigen via MHC class II [inference]

antigen processing and presentation of peptide antigen via MHC class II [inference]

antigen processing and presentation of exogenous peptide antigen via MHC class II

antigen processing and presentation of exogenous antigen [inference]

antigen processing and presentation of exogenous peptide antigen [inference]

antigen processing and presentation of exogenous peptide antigen via MHC class II

antigen processing and presentation of peptide antigen [inference]

antigen processing and presentation of exogenous peptide antigen [inference]

antigen processing and presentation of exogenous peptide antigen via MHC class II

antigen processing and presentation of peptide antigen via MHC class II [inference]

antigen processing and presentation of exogenous peptide antigen via MHC class II

cellular process [inference]

cell killing [inference]

leukocyte mediated cytotoxicity [inference]

antibody-dependent cellular cytotoxicity

signal transduction [inference]

cell surface receptor signaling pathway

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis

Fc receptor-mediated immune complex endocytosis

endosomal transport [inference]

endocytic recycling

vesicle-mediated transport to the plasma membrane [inference]

endocytic recycling

cellular localization [inference]

intracellular transport [inference]

endosomal transport [inference]

endocytic recycling

localization within membrane [inference]

vesicle-mediated transport to the plasma membrane [inference]

endocytic recycling

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to amyloid-beta

cellular response to oxygen-containing compound [inference]

cellular response to amyloid-beta

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

dendrite development

membrane organization [inference]

membrane invagination [inference]

plasma membrane invagination [inference]

phagocytosis, engulfment

developmental process [inference]

anatomical structure development [inference]

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium

response to stimulus [inference]

response to stress [inference]

defense response

inflammatory response [inference]

inflammatory response to antigenic stimulus [inference]

acute inflammatory response to antigenic stimulus [inference]

hypersensitivity [inference]

type II hypersensitivity [inference]

type IIa hypersensitivity [inference]

antibody-dependent cellular cytotoxicity

acute inflammatory response [inference]

acute inflammatory response to antigenic stimulus [inference]

hypersensitivity [inference]

type II hypersensitivity [inference]

type IIa hypersensitivity [inference]

antibody-dependent cellular cytotoxicity

immune response [inference]

adaptive immune response [inference]

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

B cell mediated immunity [inference]

immunoglobulin mediated immune response

type II hypersensitivity [inference]

type IIa hypersensitivity [inference]

antibody-dependent cellular cytotoxicity

inflammatory response to antigenic stimulus [inference]

acute inflammatory response to antigenic stimulus [inference]

hypersensitivity [inference]

type II hypersensitivity [inference]

type IIa hypersensitivity [inference]

antibody-dependent cellular cytotoxicity

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

cellular response to molecule of bacterial origin

response to other organism [inference]

response to bacterium

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

cellular response to molecule of bacterial origin

response to other organism [inference]

response to bacterium

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin

response to chemical [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to amyloid-beta

cellular response to oxygen-containing compound [inference]

cellular response to amyloid-beta

response to nitrogen compound [inference]

cellular response to nitrogen compound [inference]

cellular response to amyloid-beta

response to amyloid-beta [inference]

cellular response to amyloid-beta

response to oxygen-containing compound [inference]

cellular response to oxygen-containing compound [inference]

cellular response to amyloid-beta

response to amyloid-beta [inference]

cellular response to amyloid-beta

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to amyloid-beta

cellular response to oxygen-containing compound [inference]

cellular response to amyloid-beta

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis

Fc receptor-mediated immune complex endocytosis

endosomal transport [inference]

endocytic recycling

vesicle-mediated transport to the plasma membrane [inference]

endocytic recycling

intracellular transport [inference]

endosomal transport [inference]

endocytic recycling

import into cell [inference]

endocytosis [inference]

receptor-mediated endocytosis

Fc receptor-mediated immune complex endocytosis

establishment of localization in cell [inference]

intracellular transport [inference]

endosomal transport [inference]

endocytic recycling

cellular localization [inference]

intracellular transport [inference]

endosomal transport [inference]

endocytic recycling

localization within membrane [inference]

vesicle-mediated transport to the plasma membrane [inference]

endocytic recycling

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of immune effector process [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

negative regulation of leukocyte mediated immunity [inference]

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of immune response

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of humoral immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of B cell proliferation [inference]

negative regulation of B cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

regulation of B cell activation [inference]

regulation of B cell proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

regulation of immune effector process [inference]

negative regulation of immune effector process [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

negative regulation of leukocyte mediated immunity [inference]

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

negative regulation of immunoglobulin production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

regulation of leukocyte mediated immunity [inference]

negative regulation of leukocyte mediated immunity [inference]

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

regulation of lymphocyte mediated immunity [inference]

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

regulation of B cell mediated immunity [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

regulation of immunoglobulin mediated immune response [inference]

regulation of type I hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of immunoglobulin mediated immune response [inference]

regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin

regulation of neutrophil apoptotic process [inference]

negative regulation of neutrophil apoptotic process

regulation of immune response [inference]

regulation of adaptive immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of B cell mediated immunity [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

regulation of immunoglobulin mediated immune response [inference]

regulation of type I hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of immunoglobulin mediated immune response [inference]

regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of acute inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of hypersensitivity [inference]

regulation of type I hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of humoral immune response [inference]

negative regulation of humoral immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin

regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin

negative regulation of immune response

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of humoral immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of JNK cascade [inference]

positive regulation of JNK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic plasticity [inference]

regulation of neuronal synaptic plasticity [inference]

regulation of long-term neuronal synaptic plasticity

regulation of localization [inference]

regulation of transport [inference]

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

negative regulation of transport [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

positive regulation of response to endoplasmic reticulum stress

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of response to endoplasmic reticulum stress

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of immune effector process [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

negative regulation of leukocyte mediated immunity [inference]

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of immune response

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of humoral immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of neutrophil apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of neutrophil apoptotic process

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of cellular component organization [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of immune response

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of humoral immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin

negative regulation of transport [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of JNK cascade [inference]

positive regulation of JNK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of inflammatory response [inference]

regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of acute inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of hypersensitivity [inference]

regulation of type I hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of acute inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of hypersensitivity [inference]

regulation of type I hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of response to endoplasmic reticulum stress

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of immune response

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of humoral immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin

regulation of immune response [inference]

regulation of adaptive immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of B cell mediated immunity [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

regulation of immunoglobulin mediated immune response [inference]

regulation of type I hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of immunoglobulin mediated immune response [inference]

regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of acute inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of hypersensitivity [inference]

regulation of type I hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of humoral immune response [inference]

negative regulation of humoral immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin

regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin

negative regulation of immune response

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of humoral immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin

regulation of response to stress [inference]

regulation of defense response [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of inflammatory response [inference]

regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of acute inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of hypersensitivity [inference]

regulation of type I hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of acute inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of hypersensitivity [inference]

regulation of type I hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

negative regulation of inflammatory response to antigenic stimulus

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of hypersensitivity [inference]

negative regulation of type I hypersensitivity

regulation of cellular response to stress [inference]

regulation of response to endoplasmic reticulum stress [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of response to endoplasmic reticulum stress

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of JNK cascade [inference]

positive regulation of JNK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic plasticity [inference]

regulation of neuronal synaptic plasticity [inference]

regulation of long-term neuronal synaptic plasticity

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of interleukin-10 production [inference]

negative regulation of interleukin-10 production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

positive regulation of tumor necrosis factor production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

negative regulation of immunoglobulin production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of interleukin-10 production [inference]

negative regulation of interleukin-10 production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

positive regulation of tumor necrosis factor production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

negative regulation of immunoglobulin production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

regulation of lymphocyte proliferation [inference]

regulation of B cell proliferation [inference]

negative regulation of B cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

regulation of myeloid cell apoptotic process [inference]

regulation of neutrophil apoptotic process [inference]

negative regulation of neutrophil apoptotic process

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of neutrophil apoptotic process

negative regulation of apoptotic process [inference]

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of neutrophil apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of neutrophil apoptotic process

regulation of neuron apoptotic process [inference]

regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway

regulation of leukocyte apoptotic process [inference]

regulation of neutrophil apoptotic process [inference]

negative regulation of neutrophil apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of neutrophil apoptotic process

regulation of apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of neutrophil apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of neutrophil apoptotic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

positive regulation of response to endoplasmic reticulum stress

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of immunoglobulin production

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of neutrophil apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of neutrophil apoptotic process

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of cellular component organization [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of B cell proliferation [inference]

negative regulation of B cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

regulation of B cell activation [inference]

regulation of B cell proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

regulation of cellular component organization [inference]

regulation of endocytosis [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

regulation of cell projection organization [inference]

regulation of plasma membrane bounded cell projection organization [inference]

regulation of dendritic spine maintenance

regulation of synapse organization [inference]

regulation of postsynapse organization [inference]

regulation of dendritic spine maintenance

negative regulation of cellular component organization [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

regulation of cellular response to stress [inference]

regulation of response to endoplasmic reticulum stress [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of response to endoplasmic reticulum stress

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of interleukin-10 production [inference]

negative regulation of interleukin-10 production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

positive regulation of tumor necrosis factor production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of B cell proliferation [inference]

negative regulation of B cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

regulation of B cell activation [inference]

regulation of B cell proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

regulation of biological quality [inference]

regulation of synaptic plasticity [inference]

regulation of neuronal synaptic plasticity [inference]

regulation of long-term neuronal synaptic plasticity

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF
cytoskeleton	IEA	GO_REF
plasma membrane	ISO	GO_REF
plasma membrane	IC	PMID
plasma membrane	IDA	PMID PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

plasma membrane

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

neuron spine [inference]

dendritic spine

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

recycling endosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

recycling endosome

membraneless organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

recycling endosome

intracellular membraneless organelle [inference]

cytoskeleton

cell body

side of membrane [inference]

external side of plasma membrane

postsynapse [inference]

dendritic spine

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
amyloid-beta binding	ISO	GO_REF
IgG receptor activity	IBA	GO_REF
low-affinity IgG receptor activity	ISO	GO_REF
IgG binding	ISO	GO_REF GO_REF
IgG binding	IDA	PMID

GO Hierarchy

molecular function

binding [inference]

peptide binding [inference]

amyloid-beta binding

protein-containing complex binding

immunoglobulin binding

IgG binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

immunoglobulin receptor activity [inference]

IgG receptor activity

low-affinity IgG receptor activity

immune receptor activity [inference]

immunoglobulin receptor activity [inference]

IgG receptor activity

low-affinity IgG receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MESNWTVHVFSRTLCHMLLWTAVLNLAAGTHDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLPVLTIVAAVTGIAVAAIVIILVSLVYLKKKQVPALPGNPDHREMGETLPEEVGEYRQPSGGSVPVSPGPPSGLEPTSSSPYNPPDLEEAAKTEAENTITYSLLKHPEALDEETEHDYQNHI

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
4			G04657PL	GlyGen
65	N-linked (GlcNAc...) asparagine		G10486CT	GlycoProtDB UniProt GlyGen
92	N-linked (GlcNAc...) asparagine		G40574BA	GlycoProtDB UniProt GlyGen
166	N-linked (GlcNAc...) asparagine		G72747WU	GlycoProtDB UniProt GlyGen
173	N-linked (GlcNAc...) asparagine		G28541PG	GlycoProtDB UniProt GlyGen
unknown		10052594	G69834CE G94531EZ G39595FH G50489VC G86696LV G86753CK G15169WU G45209NR G91413ZX G17689DH G22310AV G72667IM G75235YS G30460NZ G53752TA G84452RH G14994KB G68937TM G50757KG G85542KD G23863VK G78059CC G11870QZ G44617UT G46687AB G58667NI G29880MM G61334IA G45889JQ G94854LT G74724QE G82348BZ	GlyGen GlyConnect

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
FCGR activation	Mus musculus
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell	Mus musculus
Neutrophil degranulation	Mus musculus
Regulation of actin dynamics for phagocytic cup formation	Mus musculus
Role of phospholipids in phagocytosis	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements