GlyCosmos Portal

Submissions

Rho-related GTP-binding protein RhoC

Summary

UniProt ID: P08134
Gene Symbol: ARH9 ARHC RHOC
Gene ID: 389
Organism: Homo sapiens (human)

External Links

GlyGen: P08134
PubChem: P08134
RaftProt: P08134
Re-Glyco: P08134

Annotation

Keyword: 3D-structure ADP-ribosylation Cell membrane GTP-binding Glycoprotein Methylation Prenylation Proteomics identification Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
mitotic cytokinesis	IDA	PMID
mitotic cytokinesis	IBA	GO_REF
mitotic cytokinesis	IEA	GO_REF
actin filament organization	IBA	GO_REF
signal transduction

GO Hierarchy

biological process

cellular process [inference]

signal transduction

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction

cell cycle process [inference]

cytokinesis [inference]

cytoskeleton-dependent cytokinesis [inference]

mitotic cytokinesis

mitotic cell cycle process [inference]

mitotic cytokinesis

cell motility [inference]

cell migration

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

cell junction assembly [inference]

cell-cell junction assembly [inference]

apical junction assembly

cell junction organization [inference]

cell junction assembly [inference]

cell-cell junction assembly [inference]

apical junction assembly

cell-cell junction organization [inference]

cell-cell junction assembly [inference]

apical junction assembly

supramolecular fiber organization [inference]

actin filament organization

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

positive regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of protein-containing complex assembly

positive regulation of supramolecular fiber organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of cellular process [inference]

signal transduction

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of actin filament-based process [inference]

regulation of actin cytoskeleton organization

regulation of actomyosin structure organization [inference]

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

regulation of actin filament organization [inference]

regulation of actin filament bundle assembly [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

regulation of cellular component biogenesis [inference]

regulation of actin filament bundle assembly [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

regulation of protein-containing complex assembly [inference]

positive regulation of protein-containing complex assembly

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of protein-containing complex assembly

positive regulation of supramolecular fiber organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cell motility [inference]

positive regulation of cell migration

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of cytoskeleton organization [inference]

regulation of actin cytoskeleton organization

regulation of actomyosin structure organization [inference]

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

regulation of actin filament organization [inference]

regulation of actin filament bundle assembly [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of protein-containing complex assembly [inference]

positive regulation of protein-containing complex assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of protein-containing complex assembly

positive regulation of supramolecular fiber organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of supramolecular fiber organization [inference]

regulation of actin filament organization [inference]

regulation of actin filament bundle assembly [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

positive regulation of supramolecular fiber organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of cell motility [inference]

regulation of cell migration [inference]

positive regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration

regulation of molecular function [inference]

positive regulation of molecular function [inference]

positive regulation of catalytic activity [inference]

positive regulation of hydrolase activity [inference]

positive regulation of lipase activity

regulation of catalytic activity [inference]

positive regulation of catalytic activity [inference]

positive regulation of hydrolase activity [inference]

positive regulation of lipase activity

regulation of hydrolase activity [inference]

positive regulation of hydrolase activity [inference]

positive regulation of lipase activity

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	IEA	GO_REF
endoplasmic reticulum membrane	TAS	Reactome Reactome
cytosol	TAS	Reactome
cytosol	IBA	GO_REF
cytosol	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytosol

membrane [inference]

plasma membrane

organelle membrane [inference]

endoplasmic reticulum membrane

plasma membrane region [inference]

cleavage furrow

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

stereocilium

actin-based cell projection [inference]

stereocilium

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

nucleus

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying **all 3** entries
GO Term	Evidence Code	Reference
GTPase activity	IEA	GO_REF
GTP binding	IEA	GO_REF
protein kinase binding	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

GTPase activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

kinase binding [inference]

protein kinase binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
34	O-linked (GlcNAc) tyrosine; by Photorhabdus PAU_02230	24141704		UniProt GlyGen
37	(Microbial infection) O-linked (Glc) threonine; by C.difficile toxins TcdA and TcdB	24905543		UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 8** entries
Pathway Name	Organism
G alpha (12/13) signalling events	Homo sapiens
RHO GTPases Activate Formins	Homo sapiens
RHO GTPases Activate ROCKs	Homo sapiens
RHO GTPases Activate Rhotekin and Rhophilins	Homo sapiens
RHO GTPases activate CIT	Homo sapiens
RHO GTPases activate PKNs	Homo sapiens
RHOC GTPase cycle	Homo sapiens
Sema4D induced cell migration and growth-cone collapse	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements