CD48 antigen

Summary
UniProt ID
P09326
Gene Symbol
  • BCM1
  • BLAST1
  • CD48
Gene ID
962
Organism
Homo sapiens (human)
GlyConnect
GlyGen
P09326
PubChem
P09326
RaftProt
P09326
Re-Glyco
P09326
Annotation
Keyword
  • 3D-structure
  • Alternative splicing
  • Cell membrane
  • Direct protein sequencing
  • Disulfide bond
  • GPI-anchor
  • Immunoglobulin domain
  • Reference proteome
  • Repeat
  • Secreted
  • Signal
Gene Ontology (GO)
Subcellular Location(GO Annotation)

Subcellular in which this glycoprotein is expressed are highlighted in blue.

Displaying 1 entry
GO Term
receptor ligand activity
Sequence
MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT
Glycosylation Sites
Displaying all 7 entries
Position Description PubMed ID GlyTouCan ID Source
40 N-linked (GlcNAc...) asparagine
44 N-linked (GlcNAc...) asparagine
104 N-linked (GlcNAc...) asparagine
162 N-linked (GlcNAc...) asparagine
178
189 N-linked (GlcNAc...) asparagine
206
Feature
  • ProtVista GlyGen : Glycosylation Site from GlyGen
  • ProtVista UniProt : Glycosylation Site from UniProt
Pathway
Displaying 1 entry
Pathway Name Organism
Cell surface interactions at the vascular wall Homo sapiens

About Release Notes Help Feedback

Click here to visit the beta site.


International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01


Logo License Policies Site Map

Contact: support@glycosmos.org

This work is licensed under Creative Commons Attribution 4.0 International


GlyCosmos Portal v4.3.0

Last updated: August 4, 2025