GlyCosmos Portal

Submissions

Choriogonadotropin subunit beta 7

Summary

UniProt ID: P0DN87
Gene Symbol: CGB7
Gene ID: 94027
Organism: Homo sapiens (human)

External Links

GlycoProtDB: GPDB0015595
Re-Glyco: P0DN87

Annotation

Keyword: Disulfide bond Glycoprotein Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
apoptotic process	TAS	PMID
signal transduction	TAS	PMID
G protein-coupled receptor signaling pathway	IBA	GO_REF
cell-cell signaling	TAS	PMID
female gamete generation	TAS	PMID

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling

signal transduction

G protein-coupled receptor signaling pathway

cell death [inference]

programmed cell death [inference]

apoptotic process

reproductive process [inference]

multicellular organismal reproductive process [inference]

gamete generation [inference]

female gamete generation

biological regulation [inference]

regulation of biological process [inference]

signaling [inference]

cell-cell signaling

regulation of cellular process [inference]

signal transduction

G protein-coupled receptor signaling pathway

Displaying **all 2** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
cytoplasm

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

Displaying **all 3** entries
GO Term	Evidence Code	Reference
hormone activity	TAS	PMID
hormone activity	IBA	GO_REF
hormone activity	IEA	GO_REF

GO Hierarchy

molecular function

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

hormone activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

hormone activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEMFQGLLLLLLLSMGGTWASREMLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	Source
33	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt
50	N-linked (GlcNAc...) asparagine	UniProt
141	O-linked (GalNAc...) serine	UniProt
147	O-linked (GalNAc...) serine	UniProt
152	O-linked (GalNAc...) serine	UniProt
158	O-linked (GalNAc...) serine	UniProt