GlyCosmos Portal

Submissions

Histone H1.0

Summary

UniProt ID: P10922
Gene Symbol: H1-0 H1f0 H1fv
Gene ID: 14958
Organism: Mus musculus (house mouse)

External Links

GlyGen: P10922
Re-Glyco: P10922

Annotation

Keyword: ADP-ribosylation Acetylation Chromosome Citrullination DNA-binding Nucleus Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nucleosome assembly	IEA	GO_REF
chromosome condensation	ISO	GO_REF
chromosome condensation	IBA	GO_REF
chromosome condensation	IEA	GO_REF
heterochromatin formation	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cellular component organization or biogenesis [inference]

cellular component organization [inference]

chromatin organization [inference]

chromatin remodeling [inference]

nucleosome organization [inference]

nucleosome assembly

epigenetic regulation of gene expression [inference]

negative regulation of gene expression, epigenetic [inference]

heterochromatin formation

heterochromatin organization [inference]

heterochromatin formation

organelle organization [inference]

chromosome organization [inference]

chromosome condensation

cellular component assembly [inference]

heterochromatin formation

protein-containing complex assembly [inference]

protein-DNA complex assembly [inference]

nucleosome assembly

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

protein-DNA complex assembly [inference]

nucleosome assembly

protein-DNA complex organization [inference]

nucleosome organization [inference]

nucleosome assembly

protein-DNA complex assembly [inference]

nucleosome assembly

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of gene expression, epigenetic [inference]

heterochromatin formation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of gene expression, epigenetic [inference]

heterochromatin formation

negative regulation of DNA metabolic process [inference]

negative regulation of DNA recombination

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of DNA metabolic process [inference]

negative regulation of DNA recombination

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of gene expression, epigenetic [inference]

heterochromatin formation

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

negative regulation of gene expression [inference]

negative regulation of gene expression, epigenetic [inference]

heterochromatin formation

epigenetic regulation of gene expression [inference]

negative regulation of gene expression, epigenetic [inference]

heterochromatin formation

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of gene expression, epigenetic [inference]

heterochromatin formation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of gene expression, epigenetic [inference]

heterochromatin formation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of gene expression, epigenetic [inference]

heterochromatin formation

negative regulation of DNA metabolic process [inference]

negative regulation of DNA recombination

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of DNA metabolic process [inference]

negative regulation of DNA recombination

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

negative regulation of gene expression [inference]

negative regulation of gene expression, epigenetic [inference]

heterochromatin formation

epigenetic regulation of gene expression [inference]

negative regulation of gene expression, epigenetic [inference]

heterochromatin formation

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of gene expression, epigenetic [inference]

heterochromatin formation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of gene expression, epigenetic [inference]

heterochromatin formation

negative regulation of DNA metabolic process [inference]

negative regulation of DNA recombination

regulation of DNA metabolic process [inference]

regulation of DNA recombination [inference]

negative regulation of DNA recombination

negative regulation of DNA metabolic process [inference]

negative regulation of DNA recombination

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of DNA metabolic process [inference]

negative regulation of DNA recombination

regulation of DNA metabolic process [inference]

regulation of DNA recombination [inference]

negative regulation of DNA recombination

negative regulation of DNA metabolic process [inference]

negative regulation of DNA recombination

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of gene expression, epigenetic [inference]

heterochromatin formation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of gene expression, epigenetic [inference]

heterochromatin formation

negative regulation of DNA metabolic process [inference]

negative regulation of DNA recombination

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of DNA metabolic process [inference]

negative regulation of DNA recombination

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
chromatin	ISO	GO_REF
chromatin	IEA	GO_REF
nucleosome	IEA	GO_REF
euchromatin	ISO	GO_REF
euchromatin	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

transcription regulator complex [inference]

transcription repressor complex

protein-DNA complex [inference]

nucleosome

cellular anatomical structure [inference]

chromatin

euchromatin

nucleoplasm

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton [inference]

actin cytoskeleton

nuclear body

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton [inference]

actin cytoskeleton

nuclear body

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
DNA binding	EXP	PMID
DNA binding	IEA	GO_REF
minor groove of adenine-thymine-rich DNA binding	IMP	PMID
double-stranded DNA binding	IMP	PMID
double-stranded DNA binding	IBA	GO_REF

GO Hierarchy

molecular function

structural molecule activity [inference]

structural constituent of chromatin

binding [inference]

nucleic acid binding [inference]

DNA binding

DNA secondary structure binding [inference]

minor groove of adenine-thymine-rich DNA binding

double-stranded DNA binding

chromatin DNA binding

nucleosomal DNA binding

chromatin binding [inference]

chromatin DNA binding

nucleosomal DNA binding

nucleosome binding

nucleosomal DNA binding

protein-containing complex binding [inference]

nucleosome binding

nucleosomal DNA binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKGDEPKRSVAFKKTKKEVKKVATPKKAAKPKKAASKAPSKKPKATPVKKAKKKPAATPKKAKKPKVVKVKPVKASKPKKAKTVKPKAKSSAKRASKKK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites