GlyCosmos Portal

Submissions

Fatty acid-binding protein, liver

Summary

UniProt ID: P12710
Gene Symbol: Fabp1 Fabpl
Gene ID: 14080
Organism: Mus musculus (house mouse)

External Links

GlyGen: P12710
PubChem: P12710
Re-Glyco: P12710

Annotation

Keyword: Acetylation Cytoplasm Direct protein sequencing Lipid-binding Phosphoprotein Reference proteome Selenium Transport

Gene Ontology (GO)

Displaying entries **1 - 5** of **111** in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
long-chain fatty acid metabolic process	IMP	PMID PMID PMID
long-chain fatty acid metabolic process	IGI	PMID
liver development	IMP	PMID PMID PMID PMID
reduction of food intake in response to dietary excess	IMP	PMID
glucose metabolic process	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

cell activation [inference]

fibroblast activation [inference]

hepatic stellate cell activation

signal transduction [inference]

G protein-coupled receptor signaling pathway [inference]

cannabinoid signaling pathway

endocannabinoid signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette

metabolic process [inference]

aldehyde metabolic process

generation of precursor metabolites and energy [inference]

modified amino acid metabolic process [inference]

glutathione metabolic process

sulfur compound metabolic process [inference]

glutathione metabolic process

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

phospholipid metabolic process

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nicotinamide nucleotide metabolic process [inference]

glycolytic process

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process [inference]

glycolytic process

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

organophosphate metabolic process [inference]

phospholipid metabolic process

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nicotinamide nucleotide metabolic process [inference]

glycolytic process

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process [inference]

glycolytic process

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

organophosphate catabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

catabolic process [inference]

lipid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

carbohydrate catabolic process [inference]

glycolytic process

nucleobase-containing compound catabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

small molecule catabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

organophosphate catabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

purine-containing compound catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine-containing compound catabolic process [inference]

pyridine nucleotide catabolic process [inference]

glycolytic process

carbohydrate derivative catabolic process [inference]

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

glycerolipid biosynthetic process [inference]

acylglycerol biosynthetic process

triglyceride biosynthetic process

neutral lipid biosynthetic process [inference]

acylglycerol biosynthetic process

triglyceride biosynthetic process

macromolecule biosynthetic process [inference]

gene expression

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

ketone metabolic process

hormone metabolic process [inference]

retinol metabolic process

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression

protein metabolic process [inference]

lipoprotein metabolic process

primary metabolic process [inference]

carbohydrate metabolic process [inference]

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

glucose metabolic process

glycerol metabolic process

carbohydrate catabolic process [inference]

glycolytic process

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound catabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nicotinamide nucleotide metabolic process [inference]

glycolytic process

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process [inference]

glycolytic process

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

amino acid metabolic process [inference]

proteinogenic amino acid metabolic process [inference]

L-glutamine metabolic process

alpha-amino acid metabolic process [inference]

L-amino acid metabolic process [inference]

L-glutamine metabolic process

lipid metabolic process

fatty acid metabolic process

long-chain fatty acid metabolic process

arachidonate metabolic process

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid oxidation

fatty acid beta-oxidation

unsaturated fatty acid metabolic process [inference]

neutral lipid metabolic process [inference]

acylglycerol metabolic process

triglyceride metabolic process

triglyceride biosynthetic process

monoacylglycerol metabolic process

acylglycerol biosynthetic process

triglyceride biosynthetic process

neutral lipid biosynthetic process [inference]

acylglycerol biosynthetic process

triglyceride biosynthetic process

phospholipid metabolic process

isoprenoid metabolic process [inference]

terpenoid metabolic process [inference]

diterpenoid metabolic process

retinoid metabolic process [inference]

retinol metabolic process

steroid metabolic process [inference]

bile acid metabolic process

sterol metabolic process [inference]

cholesterol metabolic process

lipid biosynthetic process [inference]

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

glycerolipid biosynthetic process [inference]

acylglycerol biosynthetic process

triglyceride biosynthetic process

neutral lipid biosynthetic process [inference]

acylglycerol biosynthetic process

triglyceride biosynthetic process

lipid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

lipid modification [inference]

lipid oxidation [inference]

fatty acid oxidation

fatty acid beta-oxidation

glycerolipid metabolic process [inference]

acylglycerol metabolic process

triglyceride metabolic process

triglyceride biosynthetic process

monoacylglycerol metabolic process

acylglycerol biosynthetic process

triglyceride biosynthetic process

glycerolipid biosynthetic process [inference]

acylglycerol biosynthetic process

triglyceride biosynthetic process

fatty acid derivative metabolic process

protein metabolic process [inference]

lipoprotein metabolic process

small molecule metabolic process [inference]

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

glucose metabolic process

alcohol metabolic process [inference]

polyol metabolic process [inference]

glycerol metabolic process

primary alcohol metabolic process [inference]

retinol metabolic process

secondary alcohol metabolic process [inference]

cholesterol metabolic process

organic acid metabolic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

icosanoid metabolic process [inference]

arachidonate metabolic process

monocarboxylic acid metabolic process [inference]

pyruvate metabolic process [inference]

glycolytic process

fatty acid metabolic process

long-chain fatty acid metabolic process

arachidonate metabolic process

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid oxidation

fatty acid beta-oxidation

unsaturated fatty acid metabolic process [inference]

bile acid metabolic process

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

proteinogenic amino acid metabolic process [inference]

L-glutamine metabolic process

alpha-amino acid metabolic process [inference]

L-amino acid metabolic process [inference]

L-glutamine metabolic process

small molecule catabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

unsaturated fatty acid biosynthetic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nicotinamide nucleotide metabolic process [inference]

glycolytic process

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process [inference]

glycolytic process

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

ketone body metabolic process

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

glycolytic process

purine-containing compound catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine-containing compound metabolic process [inference]

nicotinamide nucleotide metabolic process [inference]

glycolytic process

pyridine-containing compound catabolic process [inference]

pyridine nucleotide catabolic process [inference]

glycolytic process

olefinic compound metabolic process [inference]

carbohydrate derivative metabolic process [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

carbohydrate derivative catabolic process [inference]

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

cell population proliferation

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

myeloid leukocyte differentiation [inference]

macrophage differentiation

mononuclear cell differentiation [inference]

macrophage differentiation

myeloid cell differentiation [inference]

myeloid leukocyte differentiation [inference]

macrophage differentiation

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

cellular response to hypoxia

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

cellular response to oxygen-containing compound [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

transmembrane transport [inference]

carbohydrate transmembrane transport [inference]

monosaccharide transmembrane transport [inference]

hexose transmembrane transport [inference]

D-glucose transmembrane transport

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

vesicle organization [inference]

vesicle budding from membrane

lipid droplet organization [inference]

lipid droplet formation

organelle assembly [inference]

membraneless organelle assembly [inference]

lipid droplet formation

cellular component assembly [inference]

protein-containing complex assembly [inference]

protein-lipid complex assembly [inference]

plasma lipoprotein particle assembly [inference]

chylomicron assembly

organelle assembly [inference]

membraneless organelle assembly [inference]

lipid droplet formation

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

protein-lipid complex assembly [inference]

plasma lipoprotein particle assembly [inference]

chylomicron assembly

protein-lipid complex organization [inference]

protein-lipid complex assembly [inference]

plasma lipoprotein particle assembly [inference]

chylomicron assembly

plasma lipoprotein particle organization [inference]

plasma lipoprotein particle assembly [inference]

chylomicron assembly

membrane organization [inference]

vesicle budding from membrane

export from cell [inference]

secretion by cell [inference]

protein secretion

cellular detoxification

multicellular organismal process [inference]

cell activation [inference]

fibroblast activation [inference]

hepatic stellate cell activation

system process [inference]

renal system process [inference]

renal absorption [inference]

renal protein absorption

digestive system process

intestinal absorption

behavior [inference]

feeding behavior [inference]

adult feeding behavior

eating behavior [inference]

reduction of food intake in response to dietary excess

adult behavior [inference]

adult feeding behavior

plasma lipoprotein particle clearance [inference]

very-low-density lipoprotein particle clearance

multicellular organism growth

tissue remodeling [inference]

connective tissue replacement

multicellular organismal-level homeostasis [inference]

energy homeostasis

plasma lipoprotein particle organization [inference]

plasma lipoprotein particle assembly [inference]

chylomicron assembly

developmental process [inference]

anatomical structure development [inference]

tissue development [inference]

muscle tissue development [inference]

smooth muscle tissue development

tube development [inference]

digestive tract development

animal organ development [inference]

gland development [inference]

liver development

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

myeloid leukocyte differentiation [inference]

macrophage differentiation

mononuclear cell differentiation [inference]

macrophage differentiation

myeloid cell differentiation [inference]

myeloid leukocyte differentiation [inference]

macrophage differentiation

growth [inference]

developmental growth [inference]

multicellular organism growth

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

energy homeostasis

chemical homeostasis [inference]

lipid homeostasis [inference]

acylglycerol homeostasis [inference]

triglyceride homeostasis

sterol homeostasis [inference]

cholesterol homeostasis

response to stimulus [inference]

response to stress [inference]

response to hypoxia [inference]

cellular response to hypoxia

defense response [inference]

inflammatory response

response to oxidative stress

response to reactive oxygen species [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

response to hydrogen peroxide [inference]

cellular response to hydrogen peroxide

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

response to wounding

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

cellular response to hypoxia

response to starvation

response to abiotic stimulus [inference]

response to oxygen levels [inference]

response to decreased oxygen levels [inference]

response to hypoxia [inference]

cellular response to hypoxia

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

response to nutrient levels [inference]

response to chemical [inference]

response to lipid

response to sterol [inference]

response to cholesterol

response to fatty acid

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

cellular response to oxygen-containing compound [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

response to peptide

response to nitrogen compound [inference]

response to paracetamol

response to oxygen-containing compound [inference]

response to reactive oxygen species [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

response to hydrogen peroxide [inference]

cellular response to hydrogen peroxide

response to sterol [inference]

response to cholesterol

response to fatty acid

response to alcohol [inference]

response to cholesterol

response to paracetamol

cellular response to oxygen-containing compound [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

response to tetrachloromethane

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

cellular response to hypoxia

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

cellular response to oxygen-containing compound [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

lipoprotein localization [inference]

lipoprotein transport

protein localization to extracellular region [inference]

protein secretion

establishment of localization [inference]

transport [inference]

lipid transport

fatty acid transport

long-chain fatty acid transport

long-chain fatty acid import into cell

sterol transport [inference]

cholesterol transport [inference]

cholesterol efflux

lipid import into cell [inference]

long-chain fatty acid import into cell

carbohydrate transport [inference]

carbohydrate transmembrane transport [inference]

monosaccharide transmembrane transport [inference]

hexose transmembrane transport [inference]

D-glucose transmembrane transport

protein transport [inference]

organic anion transport [inference]

carboxylic acid transport [inference]

monocarboxylic acid transport [inference]

fatty acid transport

long-chain fatty acid transport

long-chain fatty acid import into cell

bile acid secretion

organic acid transport [inference]

carboxylic acid transport [inference]

monocarboxylic acid transport [inference]

fatty acid transport

long-chain fatty acid transport

long-chain fatty acid import into cell

bile acid secretion

organic hydroxy compound transport [inference]

sterol transport [inference]

cholesterol transport [inference]

cholesterol efflux

xenobiotic transport

secretion [inference]

secretion by cell [inference]

protein secretion

acid secretion [inference]

bile acid secretion

transmembrane transport [inference]

carbohydrate transmembrane transport [inference]

monosaccharide transmembrane transport [inference]

hexose transmembrane transport [inference]

D-glucose transmembrane transport

import into cell [inference]

long-chain fatty acid import into cell

export from cell [inference]

secretion by cell [inference]

protein secretion

establishment of protein localization [inference]

protein transport [inference]

establishment of protein localization to extracellular region [inference]

protein secretion

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of small molecule metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway [inference]

cannabinoid signaling pathway

endocannabinoid signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette

regulation of metabolic process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of small molecule metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

regulation of catabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

regulation of lipid catabolic process [inference]

regulation of fatty acid beta-oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

regulation of ketone metabolic process [inference]

regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

regulation of fatty acid oxidation [inference]

regulation of fatty acid beta-oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

regulation of small molecule metabolic process [inference]

regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

regulation of fatty acid oxidation [inference]

regulation of fatty acid beta-oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of small molecule metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

regulation of primary metabolic process [inference]

regulation of lipid metabolic process [inference]

regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

regulation of fatty acid oxidation [inference]

regulation of fatty acid beta-oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

regulation of lipid catabolic process [inference]

regulation of fatty acid beta-oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of small molecule metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone metabolic process [inference]

retinol metabolic process

detoxification [inference]

cellular detoxification

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	IDA	PMID PMID
nucleus	IBA	GO_REF
nucleoplasm	ISO	GO_REF
cytoplasm	IDA	PMID PMID
cytoplasm	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex

membrane protein complex [inference]

EMC complex

endoplasmic reticulum protein-containing complex [inference]

EMC complex

cellular anatomical structure [inference]

nucleoplasm

cytoplasm

cell cortex [inference]

cell cortex region [inference]

apical cortex

cytoplasmic region [inference]

cell cortex region [inference]

apical cortex

cytosol

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

microbody lumen [inference]

peroxisomal matrix

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
chromatin binding	IDA	PMID
long-chain fatty acid transmembrane transporter activity	ISO	GO_REF
binding	IDA	PMID
fatty acid binding	ISO	PMID GO_REF
fatty acid binding	IDA	PMID PMID PMID

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

carboxylic acid transmembrane transporter activity [inference]

monocarboxylic acid transmembrane transporter activity [inference]

fatty acid transmembrane transporter activity [inference]

long-chain fatty acid transmembrane transporter activity

lipid transmembrane transporter activity [inference]

fatty acid transmembrane transporter activity [inference]

long-chain fatty acid transmembrane transporter activity

lipid transfer activity

binding

chromatin binding

lipid binding

steroid binding [inference]

sterol binding

cholesterol binding

fatty acid binding

long-chain fatty acid binding [inference]

oleic acid binding

phospholipid binding

fatty acid derivative binding [inference]

fatty-acyl-CoA binding [inference]

long-chain fatty acyl-CoA binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

carboxylic acid binding [inference]

monocarboxylic acid binding [inference]

fatty acid binding

long-chain fatty acid binding [inference]

oleic acid binding

bile acid binding

acyl-CoA binding [inference]

fatty-acyl-CoA binding [inference]

long-chain fatty acyl-CoA binding

organic acid binding [inference]

carboxylic acid binding [inference]

monocarboxylic acid binding [inference]

fatty acid binding

long-chain fatty acid binding [inference]

oleic acid binding

bile acid binding

alcohol binding [inference]

cholesterol binding

heterocyclic compound binding

acyl-CoA binding [inference]

fatty-acyl-CoA binding [inference]

long-chain fatty acyl-CoA binding

nucleoside phosphate binding [inference]

acyl-CoA binding [inference]

fatty-acyl-CoA binding [inference]

long-chain fatty acyl-CoA binding

sulfur compound binding [inference]

acyl-CoA binding [inference]

fatty-acyl-CoA binding [inference]

long-chain fatty acyl-CoA binding

antioxidant activity

molecular carrier activity [inference]

lipid carrier activity [inference]

lipid transfer activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
2			G27058EU	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Cytoprotection by HMOX1	Mus musculus
Heme degradation	Mus musculus
Regulation of lipid metabolism by PPARalpha	Mus musculus
Triglyceride catabolism	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements