GlyCosmos Portal

Submissions

Large ribosomal subunit protein eL8

Summary

UniProt ID: P12970
Gene Symbol: Rpl7a Surf-3 Surf3
Gene ID: 27176
Organism: Mus musculus (house mouse)

External Links

GlyGen: P12970
PubChem: P12970
RaftProt: P12970
O-GlcNAcAtlas: P12970
Re-Glyco: P12970

Annotation

Keyword: 3D-structure Acetylation Cytoplasm Isopeptide bond Reference proteome Ribosomal protein Ubl conjugation

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
maturation of LSU-rRNA	IBA	GO_REF
cytoplasmic translation	NAS	PMID
cytoplasmic translation	IDA	PMID
translation at presynapse	NAS	PMID
translation at postsynapse	NAS	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

translation [inference]

cytoplasmic translation

translation at synapse [inference]

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

translation [inference]

cytoplasmic translation

translation at synapse [inference]

protein metabolic process [inference]

translation [inference]

cytoplasmic translation

translation at synapse [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

rRNA metabolic process [inference]

rRNA processing [inference]

maturation of LSU-rRNA

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

rRNA metabolic process [inference]

rRNA processing [inference]

maturation of LSU-rRNA

RNA processing [inference]

rRNA processing [inference]

maturation of LSU-rRNA

protein metabolic process [inference]

translation [inference]

cytoplasmic translation

translation at synapse [inference]

Displaying entries **1 - 5** of 25 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
nucleolus	ISO	GO_REF
nucleolus	IEA	GO_REF
cytoplasm	ISO	GO_REF
cytoplasm	NAS	PMID
cytoplasm	IDA	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

ribonucleoprotein complex [inference]

ribosomal subunit [inference]

large ribosomal subunit [inference]

cytosolic large ribosomal subunit

cellular anatomical structure [inference]

cell junction [inference]

synapse

organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nucleolus

ribosome

cytosolic ribosome

intracellular organelle [inference]

intracellular membraneless organelle [inference]

nucleolus

ribosome

cytosolic ribosome

Displaying **all 4** entries
GO Term	Evidence Code	Reference
RNA binding	IEA	GO_REF
structural constituent of ribosome	ISO	GO_REF
structural constituent of ribosome	IDA	PMID
structural constituent of ribosome	IEA	GO_REF

GO Hierarchy

molecular function

structural molecule activity [inference]

structural constituent of ribosome

binding [inference]

nucleic acid binding [inference]

RNA binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPKGKKAKGKKVAPAPAVVKKQEAKKVVNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGHLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites