GlyCosmos Portal

Submissions

Patr class I histocompatibility antigen, B-2 alpha chain

Summary

UniProt ID: P13751
Organism: Pan troglodytes (chimpanzee)

External Links

Re-Glyco: P13751

Annotation

Keyword: Disulfide bond Glycoprotein MHC I Reference proteome Signal Transmembrane helix

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
positive regulation of T cell mediated cytotoxicity	IBA	GO_REF
antigen processing and presentation of endogenous peptide antigen via MHC class Ib	IBA	GO_REF
antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent	IBA	GO_REF
immune response	IBA	GO_REF
immune response	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response

antigen processing and presentation [inference]

antigen processing and presentation via MHC class Ib [inference]

antigen processing and presentation of peptide antigen via MHC class Ib [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class Ib

antigen processing and presentation of endogenous antigen [inference]

antigen processing and presentation of endogenous peptide antigen [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class Ib

antigen processing and presentation of endogenous peptide antigen via MHC class I [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent

antigen processing and presentation of peptide antigen [inference]

antigen processing and presentation of peptide antigen via MHC class Ib [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class Ib

antigen processing and presentation of peptide antigen via MHC class I [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent

antigen processing and presentation of endogenous peptide antigen [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class Ib

antigen processing and presentation of endogenous peptide antigen via MHC class I [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent

response to stimulus [inference]

immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of immune effector process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of leukocyte mediated immunity [inference]

regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of lymphocyte mediated immunity [inference]

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of T cell mediated immunity [inference]

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of immune response [inference]

regulation of adaptive immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of T cell mediated immunity [inference]

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of cellular process [inference]

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of response to stimulus [inference]

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of immune response [inference]

regulation of adaptive immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of T cell mediated immunity [inference]

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of cellular process [inference]

regulation of cell killing [inference]

regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of cellular process [inference]

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	IEA	GO_REF
obsolete extracellular space
external side of plasma membrane	IBA	GO_REF
ER to Golgi transport vesicle membrane	IEA	GO_REF
phagocytic vesicle membrane	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

MHC protein complex [inference]

MHC class I protein complex

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane [inference]

transport vesicle membrane [inference]

ER to Golgi transport vesicle membrane

coated vesicle membrane [inference]

ER to Golgi transport vesicle membrane

endocytic vesicle membrane [inference]

phagocytic vesicle membrane

bounding membrane of organelle [inference]

Golgi membrane

endosome membrane [inference]

transport vesicle membrane [inference]

ER to Golgi transport vesicle membrane

coated vesicle membrane [inference]

ER to Golgi transport vesicle membrane

endocytic vesicle membrane [inference]

phagocytic vesicle membrane

side of membrane [inference]

external side of plasma membrane

lumenal side of membrane [inference]

lumenal side of endoplasmic reticulum membrane

Displaying **all 2** entries
GO Term	Evidence Code	Reference
signaling receptor binding	IBA	GO_REF
peptide antigen binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

antigen binding [inference]

peptide antigen binding

protein binding [inference]

signaling receptor binding

peptide binding [inference]

peptide antigen binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQVTAPRTVLLLLSAALALTETWAGSHSMKYFYTAVSRPGRGEPRFISVGYVDDTQFVWFDSDAASPREEPRAPWIEQEGPEYWDRETQISKTNAQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDMGPDGRLLRGYEQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARWAEQLRAYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites