GlyCosmos Portal

Submissions

Heat shock protein beta-1

Summary

UniProt ID: P14602
Gene Symbol: Hspb1 Hsp25 Hsp27
Gene ID: 15507
Organism: Mus musculus (house mouse)

External Links

GlyGen: P14602
PubChem: P14602
The O-GlcNAc Database: P14602
RaftProt: P14602
O-GlcNAcAtlas: P14602
Re-Glyco: P14602

Annotation

Keyword: Acetylation Alternative splicing Chaperone Cytoskeleton Direct protein sequencing Methylation Nucleus Phosphoprotein Reference proteome Stress response

Gene Ontology (GO)

Displaying entries **1 - 5** of 35 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
protein folding	ISS	GO_REF
protein folding	ISO	GO_REF
protein folding	IEA	GO_REF
response to unfolded protein	NAS	PMID
response to heat	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

protein folding

protein refolding

microtubule-based process [inference]

microtubule-based movement [inference]

transport along microtubule [inference]

axo-dendritic transport [inference]

axonal transport [inference]

anterograde axonal transport [inference]

anterograde axonal protein transport

axo-dendritic protein transport [inference]

anterograde axonal protein transport

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

vascular endothelial growth factor receptor signaling pathway

intracellular signal transduction

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

cytoskeleton-dependent intracellular transport [inference]

transport along microtubule [inference]

axo-dendritic transport [inference]

axonal transport [inference]

anterograde axonal transport [inference]

anterograde axonal protein transport

axo-dendritic protein transport [inference]

anterograde axonal protein transport

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to virus

response to stimulus [inference]

response to stress [inference]

response to heat

response to topologically incorrect protein [inference]

response to unfolded protein

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus

response to abiotic stimulus [inference]

response to temperature stimulus [inference]

response to heat

response to endogenous stimulus [inference]

response to growth factor [inference]

cellular response to growth factor stimulus [inference]

cellular response to vascular endothelial growth factor stimulus

cellular response to endogenous stimulus [inference]

cellular response to growth factor stimulus [inference]

cellular response to vascular endothelial growth factor stimulus

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

microtubule-based protein transport [inference]

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

protein localization to cell junction [inference]

protein localization to synapse [inference]

protein localization to presynapse [inference]

anterograde axonal protein transport

establishment of localization [inference]

transport [inference]

protein transport [inference]

intracellular protein transport [inference]

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

microtubule-based protein transport [inference]

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

intracellular transport [inference]

intracellular protein transport [inference]

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

cytoskeleton-dependent intracellular transport [inference]

transport along microtubule [inference]

axo-dendritic transport [inference]

axonal transport [inference]

anterograde axonal transport [inference]

anterograde axonal protein transport

axo-dendritic protein transport [inference]

anterograde axonal protein transport

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

microtubule-based transport [inference]

transport along microtubule [inference]

axo-dendritic transport [inference]

axonal transport [inference]

anterograde axonal transport [inference]

anterograde axonal protein transport

axo-dendritic protein transport [inference]

anterograde axonal protein transport

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

microtubule-based protein transport [inference]

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

establishment of protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

microtubule-based protein transport [inference]

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

cytoskeleton-dependent intracellular transport [inference]

transport along microtubule [inference]

axo-dendritic transport [inference]

axonal transport [inference]

anterograde axonal transport [inference]

anterograde axonal protein transport

axo-dendritic protein transport [inference]

anterograde axonal protein transport

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

cytoskeleton-dependent intracellular transport [inference]

transport along microtubule [inference]

axo-dendritic transport [inference]

axonal transport [inference]

anterograde axonal transport [inference]

anterograde axonal protein transport

axo-dendritic protein transport [inference]

anterograde axonal protein transport

protein transport along microtubule [inference]

axo-dendritic protein transport [inference]

anterograde axonal protein transport

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of regulatory T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of T cell activation [inference]

regulation of T cell differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of regulatory T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of regulatory T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of protein kinase C signaling

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction

regulation of protein kinase C signaling [inference]

negative regulation of protein kinase C signaling

negative regulation of intracellular signal transduction [inference]

negative regulation of protein kinase C signaling

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of protein kinase C signaling

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of chemotaxis [inference]

positive regulation of endothelial cell chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration [inference]

regulation of chemotaxis [inference]

positive regulation of chemotaxis [inference]

positive regulation of endothelial cell chemotaxis

regulation of endothelial cell chemotaxis [inference]

positive regulation of endothelial cell chemotaxis

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

positive regulation of endothelial cell migration [inference]

regulation of blood vessel endothelial cell migration [inference]

positive regulation of blood vessel endothelial cell migration

regulation of endothelial cell chemotaxis [inference]

positive regulation of endothelial cell chemotaxis

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration [inference]

positive regulation of biological process [inference]

positive regulation of locomotion [inference]

positive regulation of chemotaxis [inference]

positive regulation of endothelial cell chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration [inference]

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of endothelial cell chemotaxis

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of protein kinase C signaling

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of protein kinase C signaling

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of cellular response to oxidative stress

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of protein kinase C signaling

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of response to oxidative stress [inference]

negative regulation of cellular response to oxidative stress

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of protein kinase C signaling

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction

regulation of protein kinase C signaling [inference]

negative regulation of protein kinase C signaling

negative regulation of intracellular signal transduction [inference]

negative regulation of protein kinase C signaling

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of endothelial cell chemotaxis

regulation of chemotaxis [inference]

positive regulation of chemotaxis [inference]

positive regulation of endothelial cell chemotaxis

regulation of endothelial cell chemotaxis [inference]

positive regulation of endothelial cell chemotaxis

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of endothelial cell chemotaxis

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of protein kinase C signaling

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of response to oxidative stress [inference]

negative regulation of cellular response to oxidative stress

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of cellular response to oxidative stress [inference]

negative regulation of cellular response to oxidative stress

regulation of response to oxidative stress [inference]

regulation of cellular response to oxidative stress [inference]

negative regulation of cellular response to oxidative stress

negative regulation of response to oxidative stress [inference]

negative regulation of cellular response to oxidative stress

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of regulatory T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of regulatory T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

vascular endothelial growth factor receptor signaling pathway

intracellular signal transduction

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of protein kinase C signaling

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction

regulation of protein kinase C signaling [inference]

negative regulation of protein kinase C signaling

negative regulation of intracellular signal transduction [inference]

negative regulation of protein kinase C signaling

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of protein kinase C signaling

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of interleukin-1 production [inference]

regulation of interleukin-1 beta production [inference]

positive regulation of interleukin-1 beta production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

positive regulation of tumor necrosis factor production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of interleukin-1 production [inference]

regulation of interleukin-1 beta production [inference]

positive regulation of interleukin-1 beta production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

positive regulation of tumor necrosis factor production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of regulatory T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration [inference]

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of protein kinase C signaling

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of cellular response to oxidative stress

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of regulatory T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of T cell activation [inference]

regulation of T cell differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of regulatory T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

positive regulation of neuron projection development

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of cellular response to stress [inference]

regulation of cellular response to oxidative stress [inference]

negative regulation of cellular response to oxidative stress

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

positive regulation of endothelial cell migration [inference]

regulation of blood vessel endothelial cell migration [inference]

positive regulation of blood vessel endothelial cell migration

regulation of endothelial cell chemotaxis [inference]

positive regulation of endothelial cell chemotaxis

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration [inference]

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of interleukin-1 production [inference]

regulation of interleukin-1 beta production [inference]

positive regulation of interleukin-1 beta production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

positive regulation of tumor necrosis factor production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of regulatory T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of T cell activation [inference]

regulation of T cell differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of regulatory T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of T cell activation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

regulation of regulatory T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of regulatory T cell differentiation

Displaying entries **1 - 5** of 27 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
proteasome complex	ISS	GO_REF
proteasome complex	ISO	GO_REF
cornified envelope	IDA	PMID
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

intracellular protein-containing complex [inference]

proteasome complex

catalytic complex [inference]

peptidase complex [inference]

endopeptidase complex [inference]

proteasome complex

cellular anatomical structure [inference]

cytoplasm

neuron projection cytoplasm [inference]

axon cytoplasm

membrane [inference]

plasma membrane

cornified envelope

plasma membrane region [inference]

synaptic membrane [inference]

postsynaptic specialization membrane [inference]

postsynaptic density membrane

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

perikaryon

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

spindle

contractile muscle fiber

myofibril [inference]

cardiac myofibril

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

spindle

contractile muscle fiber

myofibril [inference]

cardiac myofibril

supramolecular complex [inference]

supramolecular polymer [inference]

supramolecular fiber [inference]

contractile muscle fiber

myofibril [inference]

cardiac myofibril

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
protein kinase C binding	IDA	PMID
protein kinase C inhibitor activity	IDA	PMID
protein kinase binding	ISO	GO_REF
protein kinase binding	IEA	GO_REF
identical protein binding	ISS	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

transcription factor binding [inference]

DNA-binding transcription factor binding [inference]

RNA polymerase II-specific DNA-binding transcription factor binding

enzyme binding [inference]

kinase binding [inference]

protein kinase binding

protein kinase C binding

ubiquitin-like protein binding [inference]

ubiquitin binding

identical protein binding

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

unfolded protein binding

protein folding chaperone

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

kinase inhibitor activity [inference]

protein kinase inhibitor activity [inference]

protein serine/threonine kinase inhibitor activity [inference]

protein kinase C inhibitor activity

kinase regulator activity [inference]

kinase inhibitor activity [inference]

protein kinase inhibitor activity [inference]

protein serine/threonine kinase inhibitor activity [inference]

protein kinase C inhibitor activity

protein kinase regulator activity [inference]

protein kinase inhibitor activity [inference]

protein serine/threonine kinase inhibitor activity [inference]

protein kinase C inhibitor activity

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

kinase inhibitor activity [inference]

protein kinase inhibitor activity [inference]

protein serine/threonine kinase inhibitor activity [inference]

protein kinase C inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MTERRVPFSLLRSPSWEPFRDWYPAHSRLFDQAFGVPRLPDEWSQWFSAAGWPGYVRPLPAATAEGPAAVTLAAPAFSRALNRQLSSGVSEIRQTADRWRVSLDVNHFAPEELTVKTKEGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQSAEITIPVTFEARAQIGGPEAGKSEQSGAK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	PubMed ID	GlyTouCan ID	Source
63	30016717 35822049 36288343 36852467 37453647 39927985 40021952 40885482	G49108TO	The O-GlcNAc Database
71	30016717 35822049 36288343 36852467 37453647 39927985 40021952 40885482	G49108TO	The O-GlcNAc Database
178	30016717 35822049 36288343 36852467 37453647 39927985 40021952 40885482	G49108TO	The O-GlcNAc Database
188	30016717 35822049 36288343 36852467 37453647 39927985 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
AUF1 (hnRNP D0) binds and destabilizes mRNA	Mus musculus
Extra-nuclear estrogen signaling	Mus musculus
MAPK6/MAPK4 signaling	Mus musculus
VEGFA-VEGFR2 Pathway	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements