GlyCosmos Portal

Submissions

Ras-related C3 botulinum toxin substrate 2

Summary

UniProt ID: P15153
Gene Symbol: RAC2
Gene ID: 5880
Organism: Homo sapiens (human)

External Links

GlyGen: P15153
PubChem: P15153
The Human Metabolome Database: HMDBP01788
The O-GlcNAc Database: P15153
RaftProt: P15153
O-GlcNAcAtlas: P15153
Re-Glyco: P15153

Annotation

Keyword: 3D-structure ADP-ribosylation Acetylation Cytoplasm Direct protein sequencing Disease variant GTP-binding Glycoprotein Hydrolase Methylation Prenylation Proteomics identification Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 33 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
chemotaxis	IBA	GO_REF
actin filament organization	IMP	PMID
actin filament organization	IBA	GO_REF
establishment or maintenance of cell polarity	IBA	GO_REF
signal transduction	TAS	PMID

GO Hierarchy

biological process

cellular process [inference]

cell adhesion [inference]

cell-cell adhesion [inference]

leukocyte cell-cell adhesion [inference]

leukocyte aggregation [inference]

lymphocyte aggregation

establishment or maintenance of cell polarity

signal transduction

G protein-coupled receptor signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction

metabolic process [inference]

respiratory burst

reactive oxygen species metabolic process [inference]

superoxide metabolic process [inference]

superoxide anion generation

cell population proliferation [inference]

leukocyte proliferation [inference]

mast cell proliferation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

cortical cytoskeleton organization

cellular component disassembly [inference]

enucleation [inference]

erythrocyte enucleation

cellular component assembly [inference]

cell projection assembly

cell projection organization [inference]

cell projection assembly

supramolecular fiber organization [inference]

actin filament organization

multicellular organismal process [inference]

multicellular organismal-level homeostasis [inference]

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

bone resorption

locomotion [inference]

taxis [inference]

chemotaxis

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

bone resorption

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of mast cell chemotaxis

regulation of granulocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of neutrophil chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of neutrophil migration

regulation of neutrophil chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

regulation of leukocyte activation [inference]

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation

regulation of immune effector process [inference]

regulation of leukocyte mediated immunity [inference]

regulation of myeloid leukocyte mediated immunity [inference]

regulation of mast cell degranulation

regulation of leukocyte degranulation [inference]

regulation of mast cell degranulation

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of leukocyte degranulation [inference]

regulation of mast cell degranulation

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of leukocyte degranulation [inference]

regulation of mast cell degranulation

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

regulation of chemotaxis [inference]

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of mast cell chemotaxis

regulation of granulocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of neutrophil chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of mast cell chemotaxis

regulation of granulocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of neutrophil chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of neutrophil migration

regulation of neutrophil chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

positive regulation of locomotion [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mast cell proliferation

positive regulation of cellular component biogenesis [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of lamellipodium organization [inference]

positive regulation of lamellipodium assembly

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of chemotaxis [inference]

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of mast cell chemotaxis

regulation of granulocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of neutrophil chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of cell morphogenesis [inference]

regulation of cell shape

regulation of cellular process [inference]

signal transduction

G protein-coupled receptor signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction

regulation of metabolic process [inference]

regulation of respiratory burst

regulation of reactive oxygen species metabolic process [inference]

regulation of hydrogen peroxide metabolic process

regulation of cell adhesion [inference]

regulation of cell-substrate adhesion

regulation of actin filament-based process [inference]

regulation of actin cytoskeleton organization

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mast cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mast cell proliferation

regulation of mast cell proliferation [inference]

positive regulation of mast cell proliferation

regulation of cellular component biogenesis [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

regulation of lamellipodium assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mast cell proliferation

positive regulation of cellular component biogenesis [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of lamellipodium organization [inference]

positive regulation of lamellipodium assembly

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of lamellipodium organization [inference]

positive regulation of lamellipodium assembly

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

regulation of lamellipodium assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

regulation of plasma membrane bounded cell projection organization [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

regulation of lamellipodium assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

regulation of lamellipodium organization [inference]

regulation of lamellipodium assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of lamellipodium organization [inference]

positive regulation of lamellipodium assembly

regulation of organelle organization [inference]

regulation of cytoskeleton organization [inference]

regulation of actin cytoskeleton organization

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of lamellipodium organization [inference]

positive regulation of lamellipodium assembly

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of leukocyte degranulation [inference]

regulation of mast cell degranulation

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of leukocyte degranulation [inference]

regulation of mast cell degranulation

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of mast cell chemotaxis

regulation of granulocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of neutrophil chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of neutrophil migration

regulation of neutrophil chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation

regulation of biological quality [inference]

regulation of cell shape

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
nuclear envelope	IEA	GO_REF
mitochondrial outer membrane	TAS	Reactome Reactome
endoplasmic reticulum membrane	TAS	Reactome Reactome
cytosol	TAS	Reactome Reactome
cytosol	IDA	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

NADPH oxidase complex

catalytic complex [inference]

oxidoreductase complex [inference]

NADPH oxidase complex

cellular anatomical structure [inference]

cytosol

membrane [inference]

plasma membrane

outer membrane [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

organelle membrane [inference]

endoplasmic reticulum membrane

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endocytic vesicle membrane [inference]

phagocytic vesicle membrane

mitochondrial membrane [inference]

mitochondrial outer membrane

bounding membrane of organelle [inference]

endocytic vesicle membrane [inference]

phagocytic vesicle membrane

organelle outer membrane [inference]

mitochondrial outer membrane

cell junction [inference]

anchoring junction [inference]

cell-substrate junction [inference]

focal adhesion

organelle envelope [inference]

nuclear envelope

cell projection

plasma membrane bounded cell projection [inference]

lamellipodium

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

membraneless organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle

intracellular membraneless organelle [inference]

cytoskeleton

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
GTPase activity	EXP	PMID
GTPase activity	TAS	PMID
GTPase activity	IEA	GO_REF GO_REF
G protein activity	IEA	GO_REF
GTP binding	IMP	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

GTPase activity

G protein activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

kinase binding [inference]

protein kinase binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

molecular function regulator activity [inference]

G protein activity

enzyme regulator activity [inference]

kinase regulator activity [inference]

protein kinase regulator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
17		24141704 29351928 35132862 40307207 40596516	G49108TO	The O-GlcNAc Database
32	O-linked (GlcNAc) tyrosine; by Photorhabdus PAU_02230	24141704		UniProt GlyGen
41		24141704 29351928 35132862 40307207 40596516	G49108TO	The O-GlcNAc Database
182		24141704 29351928 35132862 40307207 40596516	G49108TO	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 8** entries
Pathway Name	Organism
Constitutive Signaling by Aberrant PI3K in Cancer	Homo sapiens
GPVI-mediated activation cascade	Homo sapiens
PCP/CE pathway	Homo sapiens
PI3K/AKT Signaling	Homo sapiens
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling	Homo sapiens
RAC2 GTPase cycle	Homo sapiens
RHO GTPases Activate NADPH Oxidases	Homo sapiens
ROS and RNS production in phagocytes	Homo sapiens

Disease

Displaying **all 3** entries
DO ID	Disease Name	Source
DOID:0112062	immunodeficiency 73c with defective neutrophil chemotaxis and hypogammaglobulinemia	Alliance of Genome Resources
DOID:0112061	immunodeficiency 73b with defective neutrophil chemotaxis and lymphopenia	Alliance of Genome Resources
DOID:0112064	immunodeficiency 73a with defective neutrophil chemotaxis and leukocytosis	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements