GlyCosmos Portal

Submissions

Interleukin-9

Summary

UniProt ID: P15247
Gene Symbol: Il9
Gene ID: 16198
Organism: Mus musculus (house mouse)

External Links

GlyGen: P15247
PubChem: P15247
Re-Glyco: P15247

Annotation

Keyword: 3D-structure Cytokine Direct protein sequencing Glycoprotein Growth factor Pyrrolidone carboxylic acid Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
immunoglobulin mediated immune response	IGI	PMID
B cell differentiation	IGI	PMID
positive regulation of cell growth	ISO	GO_REF
positive regulation of interleukin-5 production	IMP	PMID
interleukin-9-mediated signaling pathway	ISO	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

leukocyte mediated immunity [inference]

lymphocyte mediated immunity [inference]

B cell mediated immunity [inference]

immunoglobulin mediated immune response

immune response [inference]

adaptive immune response [inference]

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

B cell mediated immunity [inference]

immunoglobulin mediated immune response

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

B cell differentiation

B cell activation [inference]

lymphocyte proliferation [inference]

B cell proliferation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

B cell differentiation

B cell activation [inference]

lymphocyte proliferation [inference]

B cell proliferation

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

interleukin-9-mediated signaling pathway

cell population proliferation [inference]

leukocyte proliferation [inference]

mononuclear cell proliferation [inference]

lymphocyte proliferation [inference]

B cell proliferation

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation [inference]

B cell differentiation

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

B cell differentiation

B cell activation [inference]

lymphocyte proliferation [inference]

B cell proliferation

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation [inference]

B cell differentiation

response to stimulus [inference]

immune response [inference]

adaptive immune response [inference]

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

B cell mediated immunity [inference]

immunoglobulin mediated immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT

regulation of growth [inference]

regulation of cell growth [inference]

positive regulation of cell growth

positive regulation of growth [inference]

positive regulation of cell growth

positive regulation of biological process [inference]

positive regulation of growth [inference]

positive regulation of cell growth

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

positive regulation of cell growth

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

interleukin-9-mediated signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

regulation of interleukin-5 production [inference]

positive regulation of interleukin-5 production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

regulation of interleukin-5 production [inference]

positive regulation of interleukin-5 production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

positive regulation of cell growth

regulation of cellular component organization [inference]

regulation of cell growth [inference]

positive regulation of cell growth

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

regulation of interleukin-5 production [inference]

positive regulation of interleukin-5 production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-5 production

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytokine activity	ISO	GO_REF GO_REF
cytokine activity	IGI	PMID
cytokine activity	IBA	GO_REF
cytokine activity	IEA	GO_REF
interleukin-9 receptor binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

interleukin-9 receptor binding

growth factor receptor binding [inference]

interleukin-9 receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLVTYILASVLLFSSVLGQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	Source
50	N-linked (GlcNAc...) asparagine	2528451	UniProt GlyGen
78	N-linked (GlcNAc...) asparagine	2528451	UniProt GlyGen
101	N-linked (GlcNAc...) asparagine	2528451	UniProt GlyGen
114	N-linked (GlcNAc...) asparagine	2528451	UniProt GlyGen