GlyCosmos Portal

Submissions

Fos-related antigen 1

Summary

UniProt ID

P15407

Gene Symbol

FOSL1
FRA1

Gene ID

8061

Organism

Homo sapiens (human)

External Links

PubChem: P15407
The O-GlcNAc Database: P15407
Re-Glyco: P15407

Annotation

Keyword: Alternative splicing DNA-binding Nucleus Phosphoprotein Proteomics identification Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
in utero embryonic development
toll-like receptor signaling pathway
regulation of transcription by RNA polymerase II	NAS	PMID PMID
regulation of transcription by RNA polymerase II	TAS	PMID
regulation of transcription by RNA polymerase II	IBA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

integrated stress response signaling

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression

cellular response to stimulus [inference]

cellular response to stress [inference]

integrated stress response signaling

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cytoplasm organization [inference]

vitellogenesis

multicellular organismal process [inference]

multicellular organism development [inference]

embryo development [inference]

embryo development ending in birth or egg hatching [inference]

chordate embryonic development [inference]

in utero embryonic development

developmental process [inference]

anatomical structure development [inference]

blood vessel development [inference]

placenta blood vessel development

multicellular organism development [inference]

embryo development [inference]

embryo development ending in birth or egg hatching [inference]

chordate embryonic development [inference]

in utero embryonic development

locomotion [inference]

taxis [inference]

chemotaxis

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to virus

response to stimulus [inference]

response to stress [inference]

defense response [inference]

response to wounding

cellular response to stress [inference]

integrated stress response signaling

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus

cellular response to stimulus [inference]

cellular response to stress [inference]

integrated stress response signaling

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

regulation of response to stress [inference]

regulation of defense response [inference]

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

integrated stress response signaling

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

regulation of DNA-templated transcription initiation [inference]

positive regulation of DNA-templated transcription initiation

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

regulation of DNA-templated transcription initiation [inference]

positive regulation of DNA-templated transcription initiation

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

regulation of DNA-templated transcription initiation [inference]

positive regulation of DNA-templated transcription initiation

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

regulation of DNA-templated transcription initiation [inference]

positive regulation of DNA-templated transcription initiation

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of miRNA metabolic process [inference]

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

regulation of DNA-templated transcription initiation [inference]

positive regulation of DNA-templated transcription initiation

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of miRNA metabolic process [inference]

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

regulation of DNA-templated transcription initiation [inference]

positive regulation of DNA-templated transcription initiation

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
chromatin	ISA	GO_REF
nucleus	ISS	GO_REF
nucleus	NAS	PMID PMID
nucleus	TAS	PMID
nucleus	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

transcription regulator complex [inference]

RNA polymerase II transcription regulator complex

nuclear protein-containing complex [inference]

RNA polymerase II transcription regulator complex

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	PMID
RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	GO_REF
DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	GO_REF
DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	GO_REF
DNA-binding transcription factor activity	TAS	PMID

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

transcription regulatory region nucleic acid binding [inference]

transcription cis-regulatory region binding [inference]

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

DNA binding [inference]

double-stranded DNA binding [inference]

sequence-specific double-stranded DNA binding

transcription cis-regulatory region binding [inference]

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

sequence-specific DNA binding [inference]

sequence-specific double-stranded DNA binding

transcription cis-regulatory region binding [inference]

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

chromatin binding [inference]

promoter-specific chromatin binding

transcription regulator activity [inference]

DNA-binding transcription factor activity

DNA-binding transcription factor activity, RNA polymerase II-specific

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
222		33214551 34019948 38665916 39531497	G49108TO	The O-GlcNAc Database
227		33214551 34019948 38665916 39531497	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
NGF-stimulated transcription	Homo sapiens

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:10534	stomach cancer	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements