GlyCosmos Portal

Submissions

Granulocyte-macrophage colony-stimulating factor receptor subunit alpha

Summary

UniProt ID: P15509
Gene Symbol: CSF2RA CSF2R CSF2RY
Gene ID: 1438
Organism: Homo sapiens (human)

External Links

GlyGen: P15509
PubChem: P15509
Re-Glyco: P15509

Annotation

Keyword: 3D-structure Alternative splicing Cell membrane Disease variant Disulfide bond Glycoprotein Proteomics identification Receptor Reference proteome Secreted Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cell surface receptor signaling pathway via JAK-STAT	IDA	PMID
positive regulation of cell population proliferation	IBA	GO_REF
cytokine-mediated signaling pathway	IBA	GO_REF
cytokine-mediated signaling pathway	IEA	GO_REF
granulocyte-macrophage colony-stimulating factor signaling pathway	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

growth hormone receptor signaling pathway

cytokine-mediated signaling pathway

granulocyte-macrophage colony-stimulating factor signaling pathway

cell surface receptor signaling pathway via STAT [inference]

cell surface receptor signaling pathway via JAK-STAT

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

growth hormone receptor signaling pathway

cytokine-mediated signaling pathway

granulocyte-macrophage colony-stimulating factor signaling pathway

cell surface receptor signaling pathway via STAT [inference]

cell surface receptor signaling pathway via JAK-STAT

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation

regulation of leukocyte proliferation [inference]

positive regulation of leukocyte proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF
cytosol	IBA	GO_REF
plasma membrane	NAS	PMID
plasma membrane	TAS	PMID Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex [inference]

growth hormone receptor complex

plasma membrane signaling receptor complex [inference]

granulocyte macrophage colony-stimulating factor receptor complex

membrane protein complex [inference]

plasma membrane protein complex [inference]

plasma membrane signaling receptor complex [inference]

granulocyte macrophage colony-stimulating factor receptor complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

side of membrane [inference]

external side of plasma membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
growth hormone receptor activity	IBA	GO_REF
peptide hormone binding	IBA	GO_REF
cytokine binding	IBA	GO_REF
signaling receptor activity	TAS	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

cytokine binding

hormone binding [inference]

peptide hormone binding

molecular transducer activity [inference]

signaling receptor activity

transmembrane signaling receptor activity [inference]

cytokine receptor activity [inference]

growth hormone receptor activity

immune receptor activity [inference]

cytokine receptor activity [inference]

growth hormone receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying entries **1 - 10** of 12 in total

1

2

Next ›

Last »
Position	Description	PubMed ID	GlyTouCan ID	Source
46	N-linked (GlcNAc...) asparagine		G12270AG	UniProt GlyGen
54	N-linked (GlcNAc...) asparagine		G76868JS	UniProt GlyGen
99	N-linked (GlcNAc...) asparagine			UniProt GlyGen
123	N-linked (GlcNAc...) asparagine			UniProt GlyGen
135	N-linked (GlcNAc...) asparagine		G49955PK	UniProt GlyGen
143				GlyGen
182	N-linked (GlcNAc...) asparagine		G23719VF	UniProt GlyGen
195	N-linked (GlcNAc...) asparagine	37074911	G62765YT G31852PQ G41247ZX	UniProt GlyGen
223	N-linked (GlcNAc...) asparagine		G80920RR	UniProt GlyGen
229	N-linked (GlcNAc...) asparagine	18692472	G28541PG	UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
Defective CSF2RA causes SMDP4	Homo sapiens
Defective CSF2RB causes SMDP5	Homo sapiens
Interleukin receptor SHC signaling	Homo sapiens
Interleukin-3, Interleukin-5 and GM-CSF signaling	Homo sapiens
RAF/MAP kinase cascade	Homo sapiens
Surfactant metabolism	Homo sapiens

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:12120	pulmonary alveolar proteinosis	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements