GlyCosmos Portal

Submissions

Galectin-3

Summary

UniProt ID: P16110
Gene Symbol: Lgals3
Gene ID
Organism: Mus musculus (house mouse)

External Links

GlyGen: P16110
PubChem: P16110
RaftProt: P16110
Re-Glyco: P16110

Annotation

Keyword: 3D-structure Acetylation Cytoplasm Differentiation Direct protein sequencing Disulfide bond IgE-binding protein Innate immunity Lectin Nucleus Phosphoprotein Reference proteome Repeat Secreted Spliceosome

Gene Ontology (GO)

Displaying entries **1 - 5** of 42 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
skeletal system development	IGI	PMID
monocyte chemotaxis	ISO	GO_REF
monocyte chemotaxis	IBA	GO_REF
mRNA processing
positive regulation of cell population proliferation	ISO	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

humoral immune response [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

innate immune response

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

alpha-beta T cell activation [inference]

NK T cell activation

leukocyte migration [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

mononuclear cell migration

monocyte chemotaxis

macrophage migration [inference]

macrophage chemotaxis

myeloid leukocyte migration [inference]

monocyte chemotaxis

granulocyte migration [inference]

granulocyte chemotaxis [inference]

eosinophil migration [inference]

eosinophil chemotaxis

neutrophil migration [inference]

neutrophil chemotaxis

macrophage migration [inference]

macrophage chemotaxis

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

alpha-beta T cell activation [inference]

NK T cell activation

cell killing [inference]

killing of cells of another organism

metabolic process [inference]

macromolecule metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing

RNA processing [inference]

cellular developmental process [inference]

cell differentiation

cell motility [inference]

cell migration [inference]

leukocyte migration [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

mononuclear cell migration

monocyte chemotaxis

macrophage migration [inference]

macrophage chemotaxis

myeloid leukocyte migration [inference]

monocyte chemotaxis

granulocyte migration [inference]

granulocyte chemotaxis [inference]

eosinophil migration [inference]

eosinophil chemotaxis

neutrophil migration [inference]

neutrophil chemotaxis

macrophage migration [inference]

macrophage chemotaxis

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

cellular component organization or biogenesis [inference]

cellular component organization [inference]

extracellular structure organization [inference]

extracellular matrix organization

external encapsulating structure organization [inference]

extracellular matrix organization

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

alpha-beta T cell activation [inference]

NK T cell activation

developmental process [inference]

anatomical structure development [inference]

system development [inference]

skeletal system development

cellular developmental process [inference]

cell differentiation

locomotion [inference]

taxis [inference]

chemotaxis [inference]

positive chemotaxis

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

innate immune response

disruption of anatomical structure in another organism [inference]

disruption of cell in another organism [inference]

killing of cells of another organism

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

innate immune response

immune response [inference]

humoral immune response [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

innate immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of immunological synapse formation

negative regulation of immune effector process [inference]

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of immune response [inference]

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of immunological synapse formation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation

regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

regulation of NK T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell [inference]

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of immunological synapse formation

regulation of immunological synapse formation [inference]

negative regulation of immunological synapse formation

regulation of immune effector process [inference]

negative regulation of immune effector process [inference]

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell [inference]

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

regulation of immune response [inference]

negative regulation of immune response [inference]

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell [inference]

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of localization [inference]

regulation of protein localization [inference]

positive regulation of protein localization [inference]

positive regulation of protein localization to cell periphery [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

regulation of protein localization to cell periphery [inference]

regulation of protein localization to plasma membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to cell periphery [inference]

positive regulation of protein localization to plasma membrane

regulation of protein localization to membrane [inference]

regulation of protein localization to plasma membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

regulation of transport [inference]

regulation of monoatomic ion transport [inference]

regulation of metal ion transport [inference]

regulation of calcium ion transport [inference]

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion import

regulation of calcium ion import [inference]

positive regulation of calcium ion import

regulation of serotonin secretion [inference]

positive regulation of serotonin secretion

positive regulation of monoatomic ion transport [inference]

positive regulation of serotonin secretion

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion import

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of serotonin secretion

regulation of secretion by cell [inference]

regulation of serotonin secretion [inference]

positive regulation of serotonin secretion

positive regulation of secretion by cell [inference]

positive regulation of serotonin secretion

positive regulation of transport [inference]

positive regulation of monoatomic ion transport [inference]

positive regulation of serotonin secretion

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion import

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of serotonin secretion

negative regulation of transport [inference]

negative regulation of endocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

negative regulation of endocytosis

regulation of cellular localization [inference]

regulation of protein localization to membrane [inference]

regulation of protein localization to plasma membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly

positive regulation of cellular component organization [inference]

positive regulation of protein-containing complex assembly

positive regulation of secretion by cell [inference]

positive regulation of serotonin secretion

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

positive regulation of transport [inference]

positive regulation of monoatomic ion transport [inference]

positive regulation of serotonin secretion

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion import

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of serotonin secretion

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

positive regulation of multicellular organismal process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

positive regulation of protein localization [inference]

positive regulation of protein localization to cell periphery [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of immunological synapse formation

negative regulation of immune effector process [inference]

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of immune response [inference]

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of cell population proliferation [inference]

negative regulation of cell proliferation in bone marrow

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of immunological synapse formation

negative regulation of cellular component organization [inference]

negative regulation of endocytosis

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of immune response [inference]

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of transport [inference]

negative regulation of endocytosis

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of immunological synapse formation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of immune response [inference]

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

regulation of immune response [inference]

negative regulation of immune response [inference]

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell [inference]

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

negative regulation of cell population proliferation [inference]

negative regulation of cell proliferation in bone marrow

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation

regulation of cell proliferation in bone marrow [inference]

negative regulation of cell proliferation in bone marrow

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of leukocyte apoptotic process [inference]

regulation of lymphocyte apoptotic process [inference]

regulation of T cell apoptotic process

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

positive regulation of protein-containing complex assembly

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly

positive regulation of cellular component organization [inference]

positive regulation of protein-containing complex assembly

positive regulation of secretion by cell [inference]

positive regulation of serotonin secretion

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of cell population proliferation [inference]

negative regulation of cell proliferation in bone marrow

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of immunological synapse formation

negative regulation of cellular component organization [inference]

negative regulation of endocytosis

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of immunological synapse formation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation

regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

regulation of NK T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell [inference]

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of immunological synapse formation

regulation of immunological synapse formation [inference]

negative regulation of immunological synapse formation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of immunological synapse formation

regulation of cellular component organization [inference]

regulation of endocytosis [inference]

negative regulation of endocytosis

regulation of protein-containing complex assembly [inference]

positive regulation of protein-containing complex assembly

negative regulation of cellular component organization [inference]

negative regulation of endocytosis

positive regulation of cellular component organization [inference]

positive regulation of protein-containing complex assembly

regulation of cellular localization [inference]

regulation of protein localization to membrane [inference]

regulation of protein localization to plasma membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

negative regulation of endocytosis

regulation of secretion by cell [inference]

regulation of serotonin secretion [inference]

positive regulation of serotonin secretion

positive regulation of secretion by cell [inference]

positive regulation of serotonin secretion

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of immunological synapse formation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation

regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

regulation of NK T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell [inference]

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of immunological synapse formation

regulation of immunological synapse formation [inference]

negative regulation of immunological synapse formation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of immunological synapse formation

positive regulation of multicellular organismal process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of NK T cell activation

negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

negative regulation of immunological synapse formation

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

Displaying entries **1 - 5** of 32 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
cornified envelope	IDA	PMID
immunological synapse	ISO	GO_REF
immunological synapse	IDA	PMID
immunological synapse	IBA	GO_REF
extracellular region	ISS	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

nuclear protein-containing complex [inference]

spliceosomal complex

ribonucleoprotein complex [inference]

spliceosomal complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane [inference]

cornified envelope

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

mitochondrial inner membrane

external encapsulating structure [inference]

extracellular matrix

cell projection [inference]

plasma membrane bounded cell projection [inference]

glial cell projection

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
protein phosphatase inhibitor activity	ISO	GO_REF
IgE binding	ISO	GO_REF GO_REF
IgE binding	IBA	GO_REF
protein phosphatase binding	ISO	GO_REF
carbohydrate binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

immunoglobulin receptor binding [inference]

Fc-gamma receptor I complex binding

enzyme binding [inference]

phosphatase binding [inference]

protein phosphatase binding

laminin binding

carbohydrate binding

monosaccharide binding

oligosaccharide binding

disaccharide binding

small molecule binding [inference]

monosaccharide binding

protein-containing complex binding [inference]

immunoglobulin binding [inference]

IgE binding

Fc-gamma receptor I complex binding

extracellular matrix binding [inference]

laminin binding

molecular transducer activity [inference]

signaling receptor activity [inference]

advanced glycation end-product receptor activity

molecular adaptor activity [inference]

protein-macromolecule adaptor activity [inference]

molecular condensate scaffold activity

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

phosphatase inhibitor activity [inference]

protein phosphatase inhibitor activity

phosphatase regulator activity [inference]

phosphatase inhibitor activity [inference]

protein phosphatase inhibitor activity

protein phosphatase regulator activity [inference]

protein phosphatase inhibitor activity

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

chemoattractant activity

signaling receptor inhibitor activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

chemoattractant activity

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

phosphatase inhibitor activity [inference]

protein phosphatase inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
75				GlyGen
84				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Neutrophil degranulation	Mus musculus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:9452	steatotic liver disease	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements