Submissions
GlyTouCan
Glycan Structure Repository
GlyComb
Glycoconjugate Repository
GlycoPOST
Glycomics MS raw data Repository
UniCarb-DR
Glycomics MS Repository for glycan annotations from GlycoWorkbench
LM-GlycoRepo
Repository for lectin-assisted multimodality data
All Resources
Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / OrganismsTools
SugarDrawer
GlycanBuilder
Glycan Converters
GlycoMaple
GlycomeAtlas
LM-GlycomeAtlas
GALAXY
MCAW
GlycoSim
GRable
Guidelines
MIRAGE
Cell adhesion molecule CEACAM1
Summary
- UniProt ID
- P16573
- Gene Symbol
- Ceacam1
- Gene ID
- 81613
- Organism
- Rattus norvegicus (Norway rat)
External Links
- PubChem
- P16573
- The Human Metabolome Database
- HMDBP12670
- Re-Glyco
- P16573
Annotation
- Keyword
- Alternative splicing Cell adhesion Cell junction Cell membrane Cell projection Cytoplasmic vesicle Direct protein sequencing Disulfide bond Glycoprotein Immunoglobulin domain Phosphoprotein Pyrrolidone carboxylic acid Reference proteome Repeat Signal Transmembrane helix
Gene Ontology (GO)
| GO Term | Evidence Code | Reference |
|---|---|---|
| regulation of cell growth | ||
| blood vessel development | ||
| blood vessel development | ||
| negative regulation of cytokine production | ||
| negative regulation of T cell mediated cytotoxicity |
GO Hierarchy
biological process
cellular process [inference]
response to stimulus [inference]
biological regulation [inference]
regulation of biological process [inference]
regulation of immune system process
negative regulation of immune system process [inference]
regulation of immune effector process [inference]
negative regulation of immune effector process [inference]
regulation of leukocyte mediated immunity [inference]
regulation of immune response [inference]
regulation of adaptive immune response [inference]
regulation of immune response to tumor cell [inference]
regulation of innate immune response [inference]
negative regulation of immune response [inference]
regulation of signaling [inference]
regulation of localization [inference]
positive regulation of biological process [inference]
negative regulation of biological process [inference]
negative regulation of immune system process [inference]
negative regulation of cellular process [inference]
negative regulation of response to stimulus [inference]
regulation of response to stimulus [inference]
regulation of response to biotic stimulus [inference]
regulation of signal transduction [inference]
regulation of response to external stimulus [inference]
negative regulation of response to stimulus [inference]
regulation of immune response [inference]
regulation of adaptive immune response [inference]
regulation of immune response to tumor cell [inference]
regulation of innate immune response [inference]
negative regulation of immune response [inference]
regulation of response to stress [inference]
regulation of developmental process [inference]
regulation of cellular process [inference]
regulation of cell communication [inference]
regulation of metabolic process [inference]
regulation of biosynthetic process [inference]
negative regulation of metabolic process [inference]
positive regulation of metabolic process [inference]
regulation of phosphorus metabolic process [inference]
regulation of macromolecule metabolic process [inference]
regulation of primary metabolic process [inference]
regulation of cell adhesion [inference]
regulation of cell killing [inference]
regulation of cell population proliferation [inference]
regulation of cell differentiation [inference]
positive regulation of cellular process [inference]
negative regulation of cellular process [inference]
regulation of cell activation [inference]
regulation of multicellular organismal process [inference]
regulation of molecular function [inference]
| GO Term | Evidence Code | Reference |
|---|---|---|
| plasma membrane | ||
| plasma membrane | ||
| plasma membrane | ||
| plasma membrane | ||
| plasma membrane |
GO Hierarchy
| GO Term | Evidence Code | Reference |
|---|---|---|
| actin binding | ||
| granulocyte colony-stimulating factor receptor binding | ||
| calmodulin binding | ||
| bile acid transmembrane transporter activity | ||
| kinase binding |
Sequence
MELASARLLRGQIPWRGLLLTASLLTYWSPLTTAQVTVDAVPPNVVEEKSVLLLAHNLPQEFQVFYWYKGTTLNPDSEIARYIRSDNMSKTGPAYSGRETIYSNGSLFFQNVNKTDERAYTLSVFDQQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGEPFVSLMCEPYTNNTSYLWSRNGESLSEGDRVTFSEGNRTLTLLNVRRTDKGYYECEARNPATFNRSDPFNLDVIYGPDAPVISPPDIYLHQGSNLNLSCHADSNPPAQYFWLINEKLQTSSQELFISNITTNNSGTYACFVNNTVTGLSRTTVKNITVFEPVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQSLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIPDPTQGNSGLSEGAIAGIVIGSVAGVALIAALAYFLYSRKTGGGSDHRDLTEHKPSTSSHNLGPSDDSPNKVDDVSYSVLNFNAQQSKRPTSASSSPTETVYSVVKKK
Glycosylation Sites
| Position | Description | PubMed ID | GlyTouCan ID | Source |
|---|---|---|---|---|
| 87 |
|
|
||
| 104 |
|
|
||
| 113 |
|
|
||
| 148 |
|
|
||
| 152 |
|
|
||
| 173 |
|
|
||
| 197 |
|
|
||
| 224 |
|
|
||
| 256 |
|
|
||
| 288 |
|
|
Feature
: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt
Pathway
| Pathway Name | Organism |
|---|---|
| Cell surface interactions at the vascular wall | Rattus norvegicus |
| Fibronectin matrix formation | Rattus norvegicus |
| Neutrophil degranulation | Rattus norvegicus |
| Post-translational modification: synthesis of GPI-anchored proteins | Rattus norvegicus |
