GlyCosmos Portal

Submissions

Natriuretic peptides B

Summary

UniProt ID: P16860
Gene Symbol: NPPB
Gene ID: 4879
Organism: Homo sapiens (human)

External Links

GlyGen: P16860
PubChem: P16860
The Human Metabolome Database: HMDBP02137
Re-Glyco: P16860

Annotation

Keyword: 3D-structure Direct protein sequencing Disulfide bond Hormone Pharmaceutical Proteoglycan Proteomics identification Reference proteome Secreted Signal Vasodilator

Gene Ontology (GO)

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of systemic arterial blood pressure	IBA	GO_REF
cardiac conduction system development	NAS	PMID
cGMP biosynthetic process	IDA	PMID
cGMP biosynthetic process	IBA	GO_REF
protein folding	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

protein folding

signal transduction [inference]

cell surface receptor signaling pathway

enzyme-linked receptor protein signaling pathway [inference]

receptor guanylyl cyclase signaling pathway

G protein-coupled receptor signaling pathway [inference]

neuropeptide signaling pathway

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cGMP metabolic process [inference]

cGMP biosynthetic process

cyclic purine nucleotide metabolic process [inference]

cGMP metabolic process [inference]

cGMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic nucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic nucleotide metabolic process [inference]

cyclic nucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic purine nucleotide metabolic process [inference]

cGMP metabolic process [inference]

cGMP biosynthetic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cGMP metabolic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic nucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cGMP metabolic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cGMP metabolic process [inference]

cGMP biosynthetic process

cyclic purine nucleotide metabolic process [inference]

cGMP metabolic process [inference]

cGMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic nucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic nucleotide metabolic process [inference]

cyclic nucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic purine nucleotide metabolic process [inference]

cGMP metabolic process [inference]

cGMP biosynthetic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cGMP metabolic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic nucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cGMP metabolic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic nucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

biosynthetic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic nucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic nucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic nucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cGMP metabolic process [inference]

cGMP biosynthetic process

cyclic purine nucleotide metabolic process [inference]

cGMP metabolic process [inference]

cGMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic nucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic nucleotide metabolic process [inference]

cyclic nucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic purine nucleotide metabolic process [inference]

cGMP metabolic process [inference]

cGMP biosynthetic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cGMP metabolic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic nucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

small molecule metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cGMP metabolic process [inference]

cGMP biosynthetic process

cyclic purine nucleotide metabolic process [inference]

cGMP metabolic process [inference]

cGMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic nucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic nucleotide metabolic process [inference]

cyclic nucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic purine nucleotide metabolic process [inference]

cGMP metabolic process [inference]

cGMP biosynthetic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cGMP metabolic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cyclic nucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cGMP metabolic process [inference]

cGMP biosynthetic process

cyclic purine nucleotide metabolic process [inference]

cGMP metabolic process [inference]

cGMP biosynthetic process

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

carbohydrate derivative metabolic process [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

cGMP metabolic process [inference]

cGMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

cGMP biosynthetic process

multicellular organismal process [inference]

system process [inference]

circulatory system process [inference]

vascular process in circulatory system [inference]

regulation of vascular permeability

blood vessel diameter maintenance

vasodilation

renal system process [inference]

regulation of urine volume [inference]

positive regulation of urine volume

developmental process [inference]

anatomical structure development [inference]

tissue development [inference]

muscle tissue development [inference]

striated muscle tissue development [inference]

cardiac muscle tissue development [inference]

cardiac conduction system development

localization [inference]

establishment of localization [inference]

transport [inference]

secretion [inference]

body fluid secretion

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

regulation of excretion [inference]

regulation of renal sodium excretion [inference]

positive regulation of renal sodium excretion

positive regulation of secretion [inference]

positive regulation of renal sodium excretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of renal sodium excretion

regulation of growth [inference]

regulation of cell growth [inference]

negative regulation of cell growth

negative regulation of growth [inference]

negative regulation of cell growth

positive regulation of biological process [inference]

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of renal sodium excretion

positive regulation of multicellular organismal process [inference]

positive regulation of renal sodium excretion

negative regulation of biological process [inference]

negative regulation of growth [inference]

negative regulation of cell growth

negative regulation of cellular process [inference]

negative regulation of cell growth

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway

enzyme-linked receptor protein signaling pathway [inference]

receptor guanylyl cyclase signaling pathway

G protein-coupled receptor signaling pathway [inference]

neuropeptide signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell growth

regulation of cellular component organization [inference]

regulation of cell growth [inference]

negative regulation of cell growth

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of excretion [inference]

regulation of renal sodium excretion [inference]

positive regulation of renal sodium excretion

regulation of renal system process [inference]

regulation of renal sodium excretion [inference]

positive regulation of renal sodium excretion

positive regulation of multicellular organismal process [inference]

positive regulation of renal sodium excretion

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of biological quality [inference]

regulation of blood pressure

negative regulation of blood pressure [inference]

negative regulation of systemic arterial blood pressure

regulation of vascular permeability

regulation of body fluid levels [inference]

body fluid secretion

regulation of urine volume [inference]

positive regulation of urine volume

regulation of anatomical structure size [inference]

regulation of tube size [inference]

regulation of tube diameter [inference]

blood vessel diameter maintenance

vasodilation

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	EXP	PMID PMID PMID PMID
extracellular region	NAS	PMID
extracellular region	TAS	PMID
extracellular region	IEA	GO_REF GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

protein-containing complex

cellular anatomical structure [inference]

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
signaling receptor binding	IDA	PMID
signaling receptor binding	IPI	PMID PMID
hormone activity	NAS	PMID
hormone activity	IBA	GO_REF
hormone activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding

hormone receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

hormone activity

diuretic hormone activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

hormone activity

diuretic hormone activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 8** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
41	O-linked (Xyl...) (chondroitin sulfate) serine	32337544		UniProt GlyGen
62	O-linked (HexNAc...) threonine; Partial	16750161 25813380	G57321FI	UniProt GlyGen
63	O-linked (HexNAc...) serine	16750161 25813380	G57321FI	UniProt GlyGen
70	O-linked (HexNAc...) serine	16750161 25813380	G57321FI	UniProt GlyGen
74	O-linked (HexNAc...) threonine	16750161 25813380	G57321FI	UniProt GlyGen
79	O-linked (HexNAc...) serine	16750161		UniProt GlyGen
84	O-linked (HexNAc...) threonine; Partial	16750161		UniProt GlyGen
97	O-linked (HexNAc...) threonine	16750161 21763278		UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Disease

Displaying **all 5** entries
DO ID	Disease Name	Source
DOID:10763	hypertension	Alliance of Genome Resources
DOID:9651	systolic heart failure	Alliance of Genome Resources
DOID:1936	atherosclerosis	Alliance of Genome Resources
DOID:5844	myocardial infarction	Alliance of Genome Resources
DOID:9970	obesity	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements