GlyCosmos Portal

Submissions

Growth hormone receptor

Summary

UniProt ID: P16882
Gene Symbol: Ghr
Gene ID: 14600
Organism: Mus musculus (house mouse)

External Links

PubChem: P16882
Re-Glyco: P16882

Annotation

Keyword: Alternative splicing Cell membrane Direct protein sequencing Disulfide bond Endocytosis Glycoprotein Phosphoprotein Receptor Reference proteome Secreted Signal Transmembrane helix Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 24 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
cell surface receptor signaling pathway via JAK-STAT	ISO	GO_REF
positive regulation of cell population proliferation	IBA	GO_REF
hormone-mediated signaling pathway	ISO	GO_REF
cytokine-mediated signaling pathway	IBA	GO_REF
taurine metabolic process	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

insulin-like growth factor receptor signaling pathway

growth hormone receptor signaling pathway

growth hormone receptor signaling pathway via JAK-STAT

cytokine-mediated signaling pathway

cell surface receptor signaling pathway via STAT [inference]

cell surface receptor signaling pathway via JAK-STAT

hormone-mediated signaling pathway

metabolic process [inference]

sulfur compound metabolic process [inference]

alkanesulfonate metabolic process [inference]

taurine metabolic process

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent macromolecule catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

hormone metabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent macromolecule catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

primary metabolic process [inference]

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

small molecule metabolic process [inference]

organic acid metabolic process [inference]

alkanesulfonate metabolic process [inference]

taurine metabolic process

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor internalization

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus

response to stimulus [inference]

response to endogenous stimulus [inference]

response to hormone [inference]

cellular response to hormone stimulus

cellular response to endogenous stimulus [inference]

cellular response to hormone stimulus

response to chemical [inference]

response to hormone [inference]

cellular response to hormone stimulus

response to lipid [inference]

response to estradiol

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus

response to nitrogen compound [inference]

response to cycloheximide

response to oxygen-containing compound [inference]

response to estradiol

response to alcohol [inference]

response to cycloheximide

response to ketone [inference]

response to cycloheximide

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor internalization

import into cell [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor internalization

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

negative regulation of signal transduction [inference]

negative regulation of growth hormone receptor signaling pathway

regulation of growth hormone receptor signaling pathway [inference]

negative regulation of growth hormone receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of growth hormone receptor signaling pathway

regulation of growth [inference]

positive regulation of growth [inference]

positive regulation of developmental growth [inference]

positive regulation of multicellular organism growth

regulation of developmental growth [inference]

regulation of multicellular organism growth

positive regulation of multicellular organism growth

positive regulation of developmental growth [inference]

positive regulation of multicellular organism growth

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of growth [inference]

positive regulation of developmental growth [inference]

positive regulation of multicellular organism growth

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of developmental process [inference]

positive regulation of developmental growth [inference]

positive regulation of multicellular organism growth

positive regulation of multicellular organismal process [inference]

positive regulation of multicellular organism growth

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of growth hormone receptor signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of growth hormone receptor signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of growth hormone receptor signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

negative regulation of signal transduction [inference]

negative regulation of growth hormone receptor signaling pathway

regulation of growth hormone receptor signaling pathway [inference]

negative regulation of growth hormone receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of response to nutrient levels

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of growth hormone receptor signaling pathway

regulation of developmental process [inference]

regulation of developmental growth [inference]

regulation of multicellular organism growth

positive regulation of multicellular organism growth

positive regulation of developmental growth [inference]

positive regulation of multicellular organism growth

positive regulation of developmental process [inference]

positive regulation of developmental growth [inference]

positive regulation of multicellular organism growth

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

insulin-like growth factor receptor signaling pathway

growth hormone receptor signaling pathway

growth hormone receptor signaling pathway via JAK-STAT

cytokine-mediated signaling pathway

cell surface receptor signaling pathway via STAT [inference]

cell surface receptor signaling pathway via JAK-STAT

hormone-mediated signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

negative regulation of signal transduction [inference]

negative regulation of growth hormone receptor signaling pathway

regulation of growth hormone receptor signaling pathway [inference]

negative regulation of growth hormone receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of growth hormone receptor signaling pathway

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of growth hormone receptor signaling pathway

regulation of multicellular organismal process [inference]

regulation of multicellular organism growth

positive regulation of multicellular organism growth

positive regulation of multicellular organismal process [inference]

positive regulation of multicellular organism growth

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone metabolic process

Displaying entries **1 - 5** of 24 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	ISO	GO_REF GO_REF
extracellular region	TAS	Reactome
extracellular region	IEA	GO_REF
extracellular region	HDA	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex

growth hormone receptor complex

cellular anatomical structure [inference]

membrane

plasma membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule

cell body [inference]

neuronal cell body

side of membrane [inference]

external side of plasma membrane

supramolecular complex [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
growth hormone receptor activity	ISO	GO_REF GO_REF
growth hormone receptor activity	IDA	PMID
growth hormone receptor activity	IBA	GO_REF
growth hormone receptor activity	IEA	GO_REF
lipid binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

growth factor binding

enzyme binding [inference]

kinase binding [inference]

protein kinase binding

protein tyrosine kinase binding

phosphatase binding [inference]

protein phosphatase binding

protein domain specific binding [inference]

SH2 domain binding

cytokine binding

identical protein binding

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

lipid binding

hormone binding [inference]

peptide hormone binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

cytokine receptor activity [inference]

growth hormone receptor activity

immune receptor activity [inference]

cytokine receptor activity [inference]

growth hormone receptor activity

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity

kinase regulator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity

protein kinase regulator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity

molecular function activator activity [inference]

enzyme activator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDLCQVFLTLALAVTSSTFSGSEATPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPELETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSCYFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQVSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRSRQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQFPWFLIIIFGIFGVAVMLFVVIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILGIHDNYKPDFYNDDSWVEFIELDIDEADVDEKTEGSDTDRLLSNDHEKSAGILGAKDDDSGRTSCYDPDILDTDFHTSDMCDGTLKFRQSQKLNMEADLLCLDQKNLKNLPYDASLGSLHPSITQTVEENKPQPLLSSETEATHQLASTPMSNPTSLANIDFYAQVSDITPAGGDVLSPGQKIKAGIAQGNTQREVATPCQENYSMNSAYFCESDAKKCIAVARRMEATSCIKPSFNQEDIYITTESLTTTAQMSETADIAPDAEMSVPDYTTVHTVQSPRGLILNATALPLPDKKNFPSSCGYVSTDQLNKIMQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
123	N-linked (GlcNAc...) asparagine	UniProt
164	N-linked (GlcNAc...) asparagine	UniProt
169	N-linked (GlcNAc...) asparagine	UniProt
208	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Growth hormone receptor signaling	Mus musculus
Prolactin receptor signaling	Mus musculus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:9521	Laron syndrome	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements