GlyCosmos Portal

Submissions

Proteasome subunit alpha type-1

Summary

UniProt ID: P18420
Gene Symbol: Psma1
Gene ID: 29668
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: P18420
Re-Glyco: P18420

Annotation

Keyword: 3D-structure Acetylation Cytoplasm Direct protein sequencing Glycoprotein Immunity Isopeptide bond Nucleus Phosphoprotein Proteasome Reference proteome Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
immune system process
negative regulation of inflammatory response to antigenic stimulus	ISO	GO_REF
negative regulation of inflammatory response to antigenic stimulus	IEA	GO_REF
proteasome-mediated ubiquitin-dependent protein catabolic process	ISO	GO_REF
proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	GO_REF

GO Hierarchy

biological process

immune system process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent macromolecule catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent macromolecule catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

primary metabolic process [inference]

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of immune response [inference]

negative regulation of inflammatory response to antigenic stimulus

regulation of immune response [inference]

regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of immune response [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of immune response [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of immune response [inference]

negative regulation of inflammatory response to antigenic stimulus

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response [inference]

negative regulation of inflammatory response to antigenic stimulus

regulation of inflammatory response [inference]

regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of inflammatory response [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of immune response [inference]

negative regulation of inflammatory response to antigenic stimulus

regulation of immune response [inference]

regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of immune response [inference]

negative regulation of inflammatory response to antigenic stimulus

regulation of response to stress [inference]

regulation of defense response [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response [inference]

negative regulation of inflammatory response to antigenic stimulus

regulation of inflammatory response [inference]

regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of inflammatory response to antigenic stimulus

negative regulation of inflammatory response [inference]

negative regulation of inflammatory response to antigenic stimulus

Displaying entries **1 - 5** of 20 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
proteasome complex	ISO	GO_REF
proteasome complex	NAS	PMID
proteasome complex	IEA	GO_REF
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

intracellular protein-containing complex [inference]

catalytic complex [inference]

proteasome core complex

peptidase complex [inference]

endopeptidase complex [inference]

proteasome complex

cellular anatomical structure [inference]

microtubule organizing center [inference]

centrosome

cytosol

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying **all 2** entries
GO Term	Evidence Code	Reference
lipopolysaccharide binding	ISO	GO_REF
lipopolysaccharide binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

lipid binding [inference]

lipopolysaccharide binding

carbohydrate derivative binding [inference]

lipopolysaccharide binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHVFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMQCNLDELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLDGLEERPQRKAQPSQAADEPAEKADEPMEH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
110	O-linked (GlcNAc) serine; alternate			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 57 in total

1

2

3

4

5

6

Next ›

Last »
Pathway Name	Organism
ABC-family protein mediated transport	Rattus norvegicus
AMPK-induced ERAD and lysosome mediated degradation of PD-L1(CD274)	Rattus norvegicus
APC/C:Cdc20 mediated degradation of Securin	Rattus norvegicus
APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1	Rattus norvegicus
AUF1 (hnRNP D0) binds and destabilizes mRNA	Rattus norvegicus
Activation of NF-kappaB in B cells	Rattus norvegicus
Antigen processing: Ub, ATP-independent proteasomal degradation	Rattus norvegicus
Antigen processing: Ubiquitination & Proteasome degradation	Rattus norvegicus
Assembly of the pre-replicative complex	Rattus norvegicus
Asymmetric localization of PCP proteins	Rattus norvegicus