GlyCosmos Portal

Submissions

Interleukin-1 alpha

Summary

UniProt ID: P18430
Gene Symbol: IL1A
Gene ID: 397094
Organism: Sus scrofa (pig)

External Links

Re-Glyco: P18430

Annotation

Keyword: Acetylation Cytokine Cytoplasm Glycoprotein Mitogen Nucleus Phosphoprotein Pyrogen Reference proteome Secreted

Gene Ontology (GO)

Displaying entries **1 - 5** of 27 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
fever generation
connective tissue replacement involved in inflammatory response wound healing
intracellular sodium ion homeostasis
inflammatory response	IBA	GO_REF
inflammatory response	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway

extrinsic apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway in absence of ligand

signal transduction in absence of ligand [inference]

extrinsic apoptotic signaling pathway in absence of ligand

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway in absence of ligand

cell death [inference]

programmed cell death [inference]

programmed cell death involved in cell development [inference]

ectopic germ cell programmed cell death

cellular developmental process [inference]

programmed cell death involved in cell development [inference]

ectopic germ cell programmed cell death

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to heat

cellular response to chemical stimulus [inference]

cellular response to lipid [inference]

cellular response to lipopolysaccharide

cellular response to oxygen-containing compound [inference]

cellular response to lipopolysaccharide

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

reproductive process [inference]

developmental process involved in reproduction [inference]

ectopic germ cell programmed cell death

multicellular organismal process [inference]

tissue remodeling [inference]

connective tissue replacement [inference]

connective tissue replacement involved in inflammatory response wound healing

multicellular organismal-level homeostasis [inference]

temperature homeostasis [inference]

heat generation [inference]

fever generation

developmental process [inference]

developmental process involved in reproduction [inference]

ectopic germ cell programmed cell death

cellular developmental process [inference]

programmed cell death involved in cell development [inference]

ectopic germ cell programmed cell death

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular sodium ion homeostasis

multicellular organismal-level homeostasis [inference]

temperature homeostasis [inference]

heat generation [inference]

fever generation

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular sodium ion homeostasis

monoatomic cation homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular sodium ion homeostasis

sodium ion homeostasis [inference]

intracellular sodium ion homeostasis

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular sodium ion homeostasis

inorganic ion homeostasis [inference]

sodium ion homeostasis [inference]

intracellular sodium ion homeostasis

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response

acute inflammatory response [inference]

acute-phase response [inference]

fever generation

response to heat [inference]

cellular response to heat

cellular response to stress [inference]

cellular response to heat

immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide [inference]

cellular response to lipopolysaccharide

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide [inference]

cellular response to lipopolysaccharide

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

response to abiotic stimulus [inference]

response to temperature stimulus [inference]

response to heat [inference]

cellular response to heat

response to chemical [inference]

response to metal ion [inference]

response to copper ion

response to lipid [inference]

response to lipopolysaccharide [inference]

cellular response to lipopolysaccharide

cellular response to lipid [inference]

cellular response to lipopolysaccharide

cellular response to chemical stimulus [inference]

cellular response to lipid [inference]

cellular response to lipopolysaccharide

cellular response to oxygen-containing compound [inference]

cellular response to lipopolysaccharide

response to oxygen-containing compound [inference]

response to lipopolysaccharide [inference]

cellular response to lipopolysaccharide

cellular response to oxygen-containing compound [inference]

cellular response to lipopolysaccharide

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to heat

cellular response to chemical stimulus [inference]

cellular response to lipid [inference]

cellular response to lipopolysaccharide

cellular response to oxygen-containing compound [inference]

cellular response to lipopolysaccharide

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

regulation of immature T cell proliferation [inference]

regulation of immature T cell proliferation in thymus [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

regulation of immature T cell proliferation [inference]

regulation of immature T cell proliferation in thymus [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of MAPK cascade [inference]

regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization [inference]

regulation of protein transport [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of establishment of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

regulation of transport [inference]

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

regulation of secretion by cell [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

regulation of protein transport [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of mitotic nuclear division

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of cell division

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

positive regulation of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of establishment of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of MAPK cascade [inference]

regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway

extrinsic apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway in absence of ligand

signal transduction in absence of ligand [inference]

extrinsic apoptotic signaling pathway in absence of ligand

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway in absence of ligand

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of MAPK cascade [inference]

regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

regulation of interleukin-2 production [inference]

positive regulation of interleukin-2 production

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

regulation of interleukin-2 production [inference]

positive regulation of interleukin-2 production

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of cell adhesion [inference]

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

negative regulation of cell population proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

regulation of immature T cell proliferation [inference]

regulation of immature T cell proliferation in thymus [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of mitotic nuclear division

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of cell division

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

regulation of immature T cell proliferation [inference]

regulation of immature T cell proliferation in thymus [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

regulation of immature T cell proliferation [inference]

regulation of immature T cell proliferation in thymus [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

regulation of nuclear division [inference]

regulation of mitotic nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

regulation of cell division [inference]

positive regulation of cell division

regulation of cell cycle [inference]

regulation of mitotic cell cycle [inference]

regulation of mitotic nuclear division [inference]

positive regulation of mitotic nuclear division

regulation of cell cycle process [inference]

regulation of mitotic nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of cell cycle process [inference]

positive regulation of mitotic nuclear division

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of mitotic nuclear division

regulation of secretion by cell [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

regulation of interleukin-2 production [inference]

positive regulation of interleukin-2 production

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

regulation of immature T cell proliferation [inference]

regulation of immature T cell proliferation in thymus [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

regulation of immature T cell proliferation [inference]

regulation of immature T cell proliferation in thymus [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of immature T cell proliferation [inference]

positive regulation of immature T cell proliferation in thymus

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

Displaying **all 5** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
nucleus	ISS	GO_REF
nucleus	IEA	GO_REF
cytosol	ISS	GO_REF
cytosol	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytosol

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying **all 5** entries
GO Term	Evidence Code	Reference
cytokine activity	IBA	GO_REF
cytokine activity	IEA	GO_REF GO_REF GO_REF
interleukin-1 receptor binding	IEA	GO_REF
copper ion binding	ISS	GO_REF
copper ion binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

interleukin-1 receptor binding

growth factor receptor binding [inference]

interleukin-1 receptor binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

copper ion binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAKVPDLFEDLKNCYSENEEYSSDIDHLSLNQKSFYDASYEPLPGDGMDKFMPLSTSKTSKTSRLNFKDSVVMAAANGKILKKRRLSLNQFITDDDLEAIANDTEEEIIKPRSATYSFQSNMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQLPVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPKLFIATRQEKLVHMAPGLPSVTDFQILENQS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
102	N-linked (GlcNAc...) asparagine			UniProt
141	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Interleukin-1 processing	Sus scrofa
Interleukin-1 signaling	Sus scrofa
Pyroptosis	Sus scrofa

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements