GlyCosmos Portal

Submissions

Basigin

Summary

UniProt ID: P18572
Gene Symbol: Bsg
Gene ID: 12215
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB

GPDB0003454

GlyConnect

Basigin

GlyGen

P18572

PubChem

P18572

The O-GlcNAc Database

P18572

Re-Glyco

P18572

Annotation

Keyword: 3D-structure Alternative splicing Angiogenesis Cell membrane Cell projection Direct protein sequencing Disulfide bond Endoplasmic reticulum Glycoprotein Immunoglobulin domain Mannose-binding Phosphoprotein Receptor Reference proteome Signal Spermatogenesis Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 30 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
angiogenesis
neural retina development	IMP	PMID PMID PMID
homophilic cell-cell adhesion	IBA	GO_REF
spermatogenesis	IMP	PMID
axon guidance	IBA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte migration [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

myeloid leukocyte migration [inference]

granulocyte migration [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

neutrophil migration [inference]

neutrophil chemotaxis

cellular process [inference]

cell adhesion [inference]

cell-cell adhesion [inference]

homophilic cell-cell adhesion

cell recognition [inference]

neuron recognition [inference]

dendrite self-avoidance

cell growth [inference]

developmental cell growth [inference]

neuron projection extension

cell motility [inference]

cell migration [inference]

leukocyte migration [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

myeloid leukocyte migration [inference]

granulocyte migration [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

neutrophil migration [inference]

neutrophil chemotaxis

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

protein localization to plasma membrane

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

neuron projection guidance [inference]

axon guidance

reproductive process [inference]

developmental process involved in reproduction [inference]

embryo implantation

multicellular organismal reproductive process [inference]

gamete generation [inference]

male gamete generation [inference]

spermatogenesis

multicellular organismal process [inference]

photoreceptor cell maintenance

developmental process [inference]

developmental process involved in reproduction [inference]

anatomical structure morphogenesis [inference]

animal organ morphogenesis [inference]

odontogenesis [inference]

odontogenesis of dentin-containing tooth

tube morphogenesis [inference]

epithelial tube morphogenesis [inference]

endothelial tube morphogenesis

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

morphogenesis of an endothelium [inference]

endothelial tube morphogenesis

epithelial tube morphogenesis [inference]

endothelial tube morphogenesis

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

anatomical structure development [inference]

neural retina development

tissue development [inference]

decidualization

growth [inference]

cell growth [inference]

developmental cell growth [inference]

neuron projection extension

developmental growth [inference]

developmental cell growth [inference]

neuron projection extension

developmental growth involved in morphogenesis [inference]

neuron projection extension

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

response to stimulus [inference]

response to endogenous stimulus [inference]

response to hormone [inference]

response to peptide hormone

response to chemical [inference]

response to hormone [inference]

response to peptide hormone

response to metal ion [inference]

response to mercury ion

response to organophosphorus [inference]

response to cAMP

response to nitrogen compound [inference]

response to purine-containing compound [inference]

response to cAMP

response to peptide hormone

response to oxygen-containing compound [inference]

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein localization to membrane [inference]

protein localization to plasma membrane

protein localization to cell periphery [inference]

protein localization to plasma membrane

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

protein localization to plasma membrane

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization [inference]

regulation of protein transport [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

regulation of matrix metallopeptidase secretion [inference]

positive regulation of matrix metallopeptidase secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

positive regulation of establishment of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

positive regulation of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

regulation of transport [inference]

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

regulation of secretion by cell [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

regulation of matrix metallopeptidase secretion [inference]

positive regulation of matrix metallopeptidase secretion

positive regulation of secretion by cell [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

regulation of protein transport [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

regulation of matrix metallopeptidase secretion [inference]

positive regulation of matrix metallopeptidase secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

regulation of biological process involved in symbiotic interaction [inference]

modulation by symbiont of entry into host [inference]

regulation of viral entry into host cell [inference]

positive regulation of viral entry into host cell

positive regulation by symbiont of entry into host [inference]

positive regulation of viral entry into host cell

positive regulation of biological process [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of viral process [inference]

positive regulation of viral life cycle [inference]

positive regulation of viral entry into host cell

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation by symbiont of entry into host [inference]

positive regulation of viral entry into host cell

positive regulation of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

positive regulation of establishment of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

regulation of viral process [inference]

positive regulation of viral process [inference]

positive regulation of viral life cycle [inference]

positive regulation of viral entry into host cell

regulation of viral life cycle [inference]

regulation of viral entry into host cell [inference]

positive regulation of viral entry into host cell

positive regulation of viral life cycle [inference]

positive regulation of viral entry into host cell

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

regulation of secretion by cell [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

regulation of matrix metallopeptidase secretion [inference]

positive regulation of matrix metallopeptidase secretion

positive regulation of secretion by cell [inference]

positive regulation of protein secretion [inference]

positive regulation of matrix metallopeptidase secretion

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

Displaying entries **1 - 5** of 24 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
photoreceptor outer segment	IDA	PMID
photoreceptor outer segment	IEA	GO_REF
photoreceptor inner segment	EXP	PMID
photoreceptor inner segment	IDA	PMID
photoreceptor inner segment	IMP	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

sarcolemma

organelle membrane [inference]

endoplasmic reticulum membrane

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

secretory granule membrane [inference]

acrosomal membrane

bounding membrane of organelle [inference]

secretory granule membrane [inference]

acrosomal membrane

plasma membrane region [inference]

basolateral plasma membrane

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

axon

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
virus receptor activity	ISO	GO_REF
D-mannose binding
signaling receptor activity	ISS	GO_REF
signaling receptor activity	ISO	GO_REF
signaling receptor activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

cell adhesion molecule binding [inference]

cell adhesion mediator activity [inference]

cell-cell adhesion mediator activity

exogenous protein binding [inference]

virus receptor activity

carbohydrate binding [inference]

monosaccharide binding [inference]

D-mannose binding

small molecule binding [inference]

monosaccharide binding [inference]

D-mannose binding

molecular transducer activity [inference]

signaling receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAALLLALAFTLLSGQGACAAAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRMAALWPFLGIVAEVLVLVTIIFIYEKRRKPDQTLDEDDPGAAPLKGSGTHMNDKDKNVRQRNAT

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
153		29187734 36288343 39627609 40885482	G49108TO	The O-GlcNAc Database
156		29187734 36288343 39627609 40885482	G49108TO	The O-GlcNAc Database
160	N-linked (GlcNAc...) asparagine	19349973 19656770 30899004	G02315DX G25814OJ	GlycoProtDB UniProt GlyGen GlyConnect
270	N-linked (GlcNAc...) asparagine	19349973 19656770 30899004	G10773YW G70101JE G80920RR G64527OM G05724UK G39188ZX G06110VR	GlycoProtDB UniProt GlyGen GlyConnect
306	N-linked (GlcNAc...) asparagine	19349973	G01650EU	GlycoProtDB UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Aspirin ADME	Mus musculus
Basigin interactions	Mus musculus
Degradation of the extracellular matrix	Mus musculus
Integrin cell surface interactions	Mus musculus
Proton-coupled monocarboxylate transport	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements