GlyCosmos Portal

Submissions

Alpha-2A adrenergic receptor

Summary

UniProt ID: P18871
Gene Symbol: A2AR ADRA2A
Gene ID: 399501
Organism: Sus scrofa (pig)

External Links

PubChem: P18871
Re-Glyco: P18871

Annotation

Keyword: Cell membrane Direct protein sequencing Disulfide bond G-protein coupled receptor Glycoprotein Methylation Palmitate Phosphoprotein Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 27 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of cytokine production	IEA	GO_REF
regulation of smooth muscle contraction	IEA	GO_REF
epidermal growth factor receptor signaling pathway	IEA	GO_REF
adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	PMID
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

cell activation [inference]

platelet activation

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

ERBB signaling pathway [inference]

epidermal growth factor receptor signaling pathway

G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-modulating G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-activating G protein-coupled receptor signaling pathway

adenylate cyclase-activating adrenergic receptor signaling pathway

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway

adenylate cyclase-inhibiting adrenergic receptor signaling pathway

phospholipase C-activating G protein-coupled receptor signaling pathway [inference]

phospholipase C-activating adrenergic receptor signaling pathway

adrenergic receptor signaling pathway [inference]

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus

multicellular organismal process [inference]

cell activation [inference]

platelet activation

system process [inference]

circulatory system process [inference]

vascular process in circulatory system [inference]

blood vessel diameter maintenance [inference]

regulation of vasoconstriction

multicellular organismal response to stress [inference]

fear response

homeostatic process [inference]

chemical homeostasis [inference]

carbohydrate homeostasis [inference]

glucose homeostasis

response to stimulus [inference]

response to stress [inference]

multicellular organismal response to stress [inference]

fear response

response to endogenous stimulus [inference]

response to hormone [inference]

cellular response to hormone stimulus

cellular response to endogenous stimulus [inference]

cellular response to hormone stimulus

response to chemical [inference]

response to hormone [inference]

cellular response to hormone stimulus

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

regulation of ERBB signaling pathway [inference]

regulation of epidermal growth factor receptor signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

negative regulation of signaling [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

presynaptic modulation of chemical synaptic transmission

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization [inference]

regulation of protein transport [inference]

regulation of protein secretion [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of establishment of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of transport [inference]

regulation of monoatomic ion transport [inference]

regulation of metal ion transport [inference]

regulation of potassium ion transport [inference]

positive regulation of potassium ion transport

regulation of calcium ion transport [inference]

negative regulation of calcium ion transport

positive regulation of monoatomic ion transport [inference]

positive regulation of potassium ion transport

negative regulation of monoatomic ion transport [inference]

negative regulation of calcium ion transport

regulation of secretion [inference]

regulation of peptide secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of norepinephrine secretion

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of catecholamine secretion [inference]

regulation of norepinephrine secretion [inference]

negative regulation of norepinephrine secretion

negative regulation of catecholamine secretion [inference]

negative regulation of norepinephrine secretion

regulation of protein secretion [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of norepinephrine secretion

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

positive regulation of transport [inference]

positive regulation of monoatomic ion transport [inference]

positive regulation of potassium ion transport

negative regulation of transport [inference]

negative regulation of monoatomic ion transport [inference]

negative regulation of calcium ion transport

negative regulation of secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of norepinephrine secretion

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of amine transport [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of norepinephrine secretion

regulation of protein transport [inference]

regulation of protein secretion [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of amine transport [inference]

regulation of catecholamine secretion [inference]

regulation of norepinephrine secretion [inference]

negative regulation of norepinephrine secretion

negative regulation of catecholamine secretion [inference]

negative regulation of norepinephrine secretion

negative regulation of amine transport [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of norepinephrine secretion

regulation of peptide transport [inference]

regulation of peptide secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of cellular localization [inference]

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

positive regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of response to wounding [inference]

positive regulation of wound healing

positive regulation of transport [inference]

positive regulation of monoatomic ion transport [inference]

positive regulation of potassium ion transport

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of lipid metabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of cell communication [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of norepinephrine secretion

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of response to stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of transport [inference]

negative regulation of monoatomic ion transport [inference]

negative regulation of calcium ion transport

negative regulation of secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of norepinephrine secretion

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of amine transport [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of norepinephrine secretion

negative regulation of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of establishment of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

regulation of ERBB signaling pathway [inference]

regulation of epidermal growth factor receptor signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of response to wounding [inference]

positive regulation of wound healing

negative regulation of response to stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of response to stress [inference]

regulation of response to wounding [inference]

regulation of wound healing [inference]

positive regulation of wound healing

positive regulation of response to wounding [inference]

positive regulation of wound healing

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

ERBB signaling pathway [inference]

epidermal growth factor receptor signaling pathway

G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-modulating G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-activating G protein-coupled receptor signaling pathway

adenylate cyclase-activating adrenergic receptor signaling pathway

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway

adenylate cyclase-inhibiting adrenergic receptor signaling pathway

phospholipase C-activating G protein-coupled receptor signaling pathway [inference]

phospholipase C-activating adrenergic receptor signaling pathway

adrenergic receptor signaling pathway [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

regulation of ERBB signaling pathway [inference]

regulation of epidermal growth factor receptor signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

negative regulation of cell communication [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

presynaptic modulation of chemical synaptic transmission

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of lipid metabolic process [inference]

negative regulation of lipid catabolic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of lipid catabolic process [inference]

negative regulation of lipid catabolic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

positive regulation of proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of primary metabolic process [inference]

regulation of lipid metabolic process [inference]

negative regulation of lipid metabolic process [inference]

negative regulation of lipid catabolic process

regulation of lipid catabolic process [inference]

negative regulation of lipid catabolic process

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

positive regulation of proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of lipid metabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of cell communication [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of norepinephrine secretion

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of cellular localization [inference]

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of catecholamine secretion [inference]

regulation of norepinephrine secretion [inference]

negative regulation of norepinephrine secretion

negative regulation of catecholamine secretion [inference]

negative regulation of norepinephrine secretion

regulation of protein secretion [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of norepinephrine secretion

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of cell motility [inference]

regulation of cell migration [inference]

positive regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production

regulation of system process [inference]

regulation of muscle system process [inference]

regulation of muscle contraction [inference]

regulation of smooth muscle contraction

regulation of blood circulation [inference]

regulation of vasoconstriction

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production

regulation of biological quality [inference]

regulation of hormone levels [inference]

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of anatomical structure size [inference]

regulation of tube size [inference]

regulation of tube diameter [inference]

blood vessel diameter maintenance [inference]

regulation of vasoconstriction

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	IEA	GO_REF
plasma membrane	ISS	GO_REF
plasma membrane	IDA	PMID
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex

cellular anatomical structure [inference]

cytoplasm

membrane [inference]

plasma membrane

cell junction [inference]

synapse [inference]

dopaminergic synapse

presynapse

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
alpha2-adrenergic receptor activity	IDA	PMID
alpha2-adrenergic receptor activity	IBA	GO_REF
alpha2-adrenergic receptor activity	IEA	GO_REF GO_REF GO_REF
protein kinase binding	IEA	GO_REF
alpha-1B adrenergic receptor binding	IPI	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

G protein-coupled receptor binding [inference]

adrenergic receptor binding [inference]

enzyme binding [inference]

kinase binding [inference]

protein kinase binding

thioesterase binding

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

hormone binding [inference]

epinephrine binding

protein-containing complex binding [inference]

heterotrimeric G-protein binding

catecholamine binding [inference]

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity [inference]

G protein-coupled amine receptor activity [inference]

adrenergic receptor activity [inference]

alpha-adrenergic receptor activity [inference]

alpha2-adrenergic receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MFRQEQPLAEGSFAPMGSLQPEAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKAGGGGQQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAAAALPGGAERRPNGLGPERGVGRVGAEAEPLPVQLNGAPGEPAPAGPRDADGLDLEESSSSEHAERPPGPRRSERGPRAKSKARASQVKPGDSLPRRGPGAPGPGAPATGAGEERGGVAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPPTLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
25	N-linked (GlcNAc...) asparagine			UniProt
29	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
Adrenaline signalling through Alpha-2 adrenergic receptor	Sus scrofa
Adrenaline,noradrenaline inhibits insulin secretion	Sus scrofa
Adrenoceptors	Sus scrofa
G alpha (i) signalling events	Sus scrofa
G alpha (z) signalling events	Sus scrofa
Surfactant metabolism	Sus scrofa

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements