GlyCosmos Portal

Submissions

Chorionic somatomammotropin hormone 2

Summary

UniProt ID: P19159
Gene Symbol: CSH2 PL2
Gene ID
Organism: Bos taurus (domestic cattle)

External Links

Re-Glyco: P19159

Annotation

Keyword: Disulfide bond Glycoprotein Hormone Metal-binding Reference proteome Secreted Signal Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cell surface receptor signaling pathway	IBA	GO_REF
female pregnancy	IBA	GO_REF
positive regulation of biosynthetic process
mammary gland development	IBA	GO_REF
response to nutrient levels	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway

reproductive process [inference]

multi-organism reproductive process [inference]

female pregnancy

multicellular organismal process [inference]

multi-multicellular organism process [inference]

female pregnancy

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

gland development [inference]

mammary gland development

response to stimulus [inference]

response to nutrient levels

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of lactation

regulation of lactation [inference]

positive regulation of lactation

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of lactation

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of lactation

positive regulation of developmental process [inference]

positive regulation of lactation

positive regulation of multicellular organismal process [inference]

positive regulation of lactation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of developmental process [inference]

positive regulation of developmental process [inference]

positive regulation of lactation

regulation of multicellular organismal development [inference]

regulation of lactation [inference]

positive regulation of lactation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of lactation

regulation of multicellular organismal development [inference]

regulation of lactation [inference]

positive regulation of lactation

regulation of biological quality [inference]

regulation of body fluid levels [inference]

regulation of lactation [inference]

positive regulation of lactation

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying **all 4** entries
GO Term	Evidence Code	Reference
prolactin receptor binding	IBA	GO_REF
hormone activity	IBA	GO_REF
hormone activity	IEA	GO_REF
metal ion binding

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

prolactin receptor binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

hormone activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

hormone activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAPAPSFRGHQWTYNPVRGSCLLLLLVVSNLLLCQGISCPSCGPDMFVSLQKSLIDVFINAASLSHDFHNLSTIMFNEFDEKYAQGKLYYINATKSCHTNSFHTPEERDKAQQMNNEDLSKWTLVLLYSWNNPLYYLLLELRNMKNLSEAVISSAMEIENMSEKLQAFIESQFRKIIVPVLKMIHEVSDTWSRFSSMTFSDEDRSISEYYNLFYCLRRDSRKVDMYIKILTCRTRKTC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
70	N-linked (GlcNAc...) asparagine	UniProt
92	N-linked (GlcNAc...) asparagine	UniProt
146	N-linked (GlcNAc...) asparagine	UniProt
160	N-linked (GlcNAc...) asparagine	UniProt