GlyCosmos Portal

Submissions

NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

Summary

UniProt ID: P19234
Gene Symbol: Ndufv2
Gene ID: 81728
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen: P19234
PubChem: P19234
The O-GlcNAc Database: P19234
O-GlcNAcAtlas: P19234
Re-Glyco: P19234

Annotation

Keyword: 2Fe-2S Direct protein sequencing Mitochondrion inner membrane NAD Oxidoreductase Phosphoprotein Reference proteome Respiratory chain Transit peptide Translocase Ubiquinone

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrial electron transport, NADH to ubiquinone	ISS	GO_REF
mitochondrial electron transport, NADH to ubiquinone	ISO	GO_REF
mitochondrial electron transport, NADH to ubiquinone	IBA	GO_REF
mitochondrial electron transport, NADH to ubiquinone	IEA	GO_REF
nervous system development	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

generation of precursor metabolites and energy [inference]

energy derivation by oxidation of organic compounds [inference]

cellular respiration [inference]

aerobic respiration [inference]

aerobic electron transport chain [inference]

mitochondrial electron transport, NADH to ubiquinone

electron transport chain [inference]

respiratory electron transport chain [inference]

aerobic electron transport chain [inference]

mitochondrial electron transport, NADH to ubiquinone

developmental process [inference]

anatomical structure development [inference]

tissue development [inference]

muscle tissue development [inference]

striated muscle tissue development [inference]

cardiac muscle tissue development

system development [inference]

nervous system development

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	ISO	GO_REF
mitochondrial inner membrane	ISS	GO_REF
mitochondrial inner membrane	ISO	GO_REF
mitochondrial inner membrane	IEA	GO_REF GO_REF
respiratory chain complex I	ISS	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

NADH dehydrogenase complex [inference]

respiratory chain complex I

transmembrane transporter complex [inference]

respiratory chain complex I

respiratory chain complex [inference]

respiratory chain complex I

catalytic complex [inference]

oxidoreductase complex [inference]

NADH dehydrogenase complex [inference]

respiratory chain complex I

transporter complex [inference]

transmembrane transporter complex [inference]

respiratory chain complex I

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

mitochondrial inner membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
NADH dehydrogenase (ubiquinone) activity	ISS	GO_REF
NADH dehydrogenase (ubiquinone) activity	ISO	GO_REF
NADH dehydrogenase (ubiquinone) activity	IEA	GO_REF GO_REF GO_REF
oxidoreductase activity	IEA	GO_REF
metal ion binding

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

proton transmembrane transporter activity [inference]

NADH dehydrogenase (ubiquinone) activity

active monoatomic ion transmembrane transporter activity [inference]

NADH dehydrogenase (ubiquinone) activity

active transmembrane transporter activity [inference]

primary active transmembrane transporter activity [inference]

oxidoreduction-driven active transmembrane transporter activity [inference]

NADH dehydrogenase (ubiquinone) activity

active monoatomic ion transmembrane transporter activity [inference]

NADH dehydrogenase (ubiquinone) activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

metal cluster binding [inference]

iron-sulfur cluster binding [inference]

2 iron, 2 sulfur cluster binding

electron transfer activity [inference]

NADH dehydrogenase (ubiquinone) activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MFSLALRARASGLTAQWGRHARNLHKTAVQNGAGGALFVHRDTPENNPDTPFDFTPENYERIEAIVRNYPEGHRAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDDYYEDLTPKDIEEIIDELRAGKVPKPGPRSGRFCCEPAGGLTSLTEPPKGPGFGVQAGL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites