GlyCosmos Portal

Submissions

Interleukin-5 receptor subunit alpha

Summary

UniProt ID: P21183
Gene Symbol: Il5ra Il5r
Gene ID: 16192
Organism: Mus musculus (house mouse)

External Links

PubChem: P21183
Re-Glyco: P21183

Annotation

Keyword: Disulfide bond Glycoprotein Receptor Reference proteome Repeat Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
inflammatory response to antigenic stimulus	IMP	PMID
positive regulation of cell population proliferation	IBA	GO_REF
cytokine-mediated signaling pathway	IBA	GO_REF
eosinophil differentiation	ISO	GO_REF
regulation of interleukin-5 production	IMP	PMID

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

inflammatory response to antigenic stimulus

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway

interleukin-5-mediated signaling pathway

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

myeloid leukocyte differentiation [inference]

granulocyte differentiation [inference]

eosinophil differentiation

myeloid cell differentiation [inference]

myeloid leukocyte differentiation [inference]

granulocyte differentiation [inference]

eosinophil differentiation

cell development [inference]

eosinophil differentiation

developmental process [inference]

anatomical structure development [inference]

cell development [inference]

eosinophil differentiation

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

myeloid leukocyte differentiation [inference]

granulocyte differentiation [inference]

eosinophil differentiation

myeloid cell differentiation [inference]

myeloid leukocyte differentiation [inference]

granulocyte differentiation [inference]

eosinophil differentiation

cell development [inference]

eosinophil differentiation

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response [inference]

inflammatory response to antigenic stimulus

immune response [inference]

inflammatory response to antigenic stimulus

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway

interleukin-5-mediated signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

regulation of interleukin-5 production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

regulation of interleukin-5 production

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

regulation of interleukin-5 production

Displaying **all 3** entries
GO Term	Evidence Code	Reference
plasma membrane	ISO	GO_REF
external side of plasma membrane	IBA	GO_REF
signaling receptor complex	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

side of membrane [inference]

external side of plasma membrane

Displaying **all 5** entries
GO Term	Evidence Code	Reference
cytokine receptor activity	IBA	GO_REF
cytokine receptor activity	IEA	GO_REF
interleukin-5 receptor activity	ISO	GO_REF
interleukin-5 receptor activity	IEA	GO_REF
cytokine binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

cytokine binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

cytokine receptor activity

interleukin-5 receptor activity

immune receptor activity [inference]

cytokine receptor activity

interleukin-5 receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVPVLLILVGALATLQADLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWHLIVLPTAACFVLLIFSLICRVCHLWTRLFPPVPAPKSNIKDLPVVTEYEKPSNETKIEVVHCVEEVGFEVMGNSTF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
32	N-linked (GlcNAc...) asparagine	UniProt
128	N-linked (GlcNAc...) asparagine	UniProt
213	N-linked (GlcNAc...) asparagine	UniProt
241	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Interleukin receptor SHC signaling	Mus musculus
Interleukin-3, Interleukin-5 and GM-CSF signaling	Mus musculus
RAF/MAP kinase cascade	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements