Submissions
GlyTouCan
Glycan Structure Repository
GlyComb
Glycoconjugate Repository
GlycoPOST
Glycomics MS raw data Repository
UniCarb-DR
Glycomics MS Repository for glycan annotations from GlycoWorkbench
LM-GlycoRepo
Repository for lectin-assisted multimodality data
All Resources
Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / OrganismsTools
SugarDrawer
GlycanBuilder
Glycan Converters
GlycoMaple
GlycomeAtlas
LM-GlycomeAtlas
GALAXY
MCAW
GlycoSim
GRable
Guidelines
MIRAGE
Bone morphogenetic protein 4
Summary
- UniProt ID
- P21275
- Gene Symbol
- Bmp-4 Bmp4 Dvr-4
- Gene ID
- 12159
- Organism
- Mus musculus (house mouse)
Annotation
- Keyword
- Chondrogenesis Cleavage on pair of basic residues Cytokine Developmental protein Differentiation Disulfide bond Extracellular matrix Glycoprotein Growth factor Osteogenesis Phosphoprotein Reference proteome Signal
Gene Ontology (GO)
| GO Term | Evidence Code | Reference |
|---|---|---|
| negative regulation of transcription by RNA polymerase II | ||
| negative regulation of transcription by RNA polymerase II | ||
| negative regulation of transcription by RNA polymerase II | ||
| skeletal system development | ||
| skeletal system development |
GO Hierarchy
- regulation of cell fate commitment
- regulation of cell fate commitment
biological process
cellular process [inference]
multicellular organismal process [inference]
developmental process [inference]
anatomical structure morphogenesis [inference]
anatomical structure development [inference]
cellular developmental process [inference]
response to stimulus [inference]
biological regulation [inference]
regulation of biological process [inference]
regulation of immune system process [inference]
regulation of signaling [inference]
regulation of localization [inference]
regulation of locomotion [inference]
positive regulation of biological process [inference]
positive regulation of cellular process [inference]
positive regulation of metabolic process [inference]
positive regulation of cell communication [inference]
positive regulation of cell differentiation
positive regulation of response to stimulus [inference]
positive regulation of developmental process [inference]
negative regulation of biological process [inference]
negative regulation of immune system process [inference]
negative regulation of cellular process [inference]
negative regulation of developmental process [inference]
negative regulation of multicellular organismal process [inference]
regulation of response to stimulus [inference]
regulation of developmental process [inference]
regulation of anatomical structure morphogenesis [inference]
regulation of cell differentiation
regulation of epithelial cell differentiation [inference]
positive regulation of cell differentiation
regulation of muscle cell differentiation [inference]
regulation of cell development [inference]
negative regulation of developmental process [inference]
positive regulation of developmental process [inference]
regulation of multicellular organismal development [inference]
regulation of cellular process [inference]
regulation of cell communication [inference]
regulation of metabolic process [inference]
regulation of biosynthetic process [inference]
negative regulation of metabolic process [inference]
positive regulation of metabolic process [inference]
regulation of macromolecule metabolic process [inference]
regulation of macromolecule biosynthetic process [inference]
regulation of RNA metabolic process [inference]
regulation of primary metabolic process [inference]
regulation of cell adhesion [inference]
regulation of transmembrane transport [inference]
regulation of cell population proliferation [inference]
regulation of programmed cell death [inference]
regulation of cell differentiation
regulation of epithelial cell differentiation [inference]
positive regulation of cell differentiation
regulation of muscle cell differentiation [inference]
regulation of cell development [inference]
positive regulation of cellular process [inference]
positive regulation of metabolic process [inference]
positive regulation of cell communication [inference]
positive regulation of cell differentiation
negative regulation of cellular process [inference]
regulation of cell activation [inference]
regulation of cellular component organization [inference]
regulation of multicellular organismal process [inference]
regulation of cell activation [inference]
negative regulation of multicellular organismal process [inference]
regulation of multicellular organismal development [inference]
| GO Term | Evidence Code | Reference |
|---|---|---|
| extracellular region | ||
| extracellular region | ||
| extracellular region | ||
| extracellular region | ||
| obsolete extracellular space |
|
|
| GO Term | Evidence Code | Reference |
|---|---|---|
| cytokine activity | ||
| cytokine activity | ||
| cytokine activity | ||
| growth factor activity | ||
| growth factor activity |
Sequence
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERPASRANTVRSFHHEEHLENIPGTSESSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRINIYEVMKPPAEMVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGDWAQLRPLLVTFGHDGRGHTLTRRRAKRSPKHHPQRSRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Glycosylation Sites
Feature
: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt
Pathway
| Pathway Name | Organism |
|---|---|
| Molecules associated with elastic fibres | Mus musculus |
| Post-translational protein phosphorylation | Mus musculus |
| Regulation of IGF Activity by IGFBP | Mus musculus |
Disease
| DO ID | Disease Name | Source |
|---|---|---|
| DOID:13374 | fibrodysplasia ossificans progressiva | |
| DOID:0080313 | cleft palate-lateral synechia syndrome | |
| DOID:0050651 | atrioventricular septal defect | |
| DOID:0080015 | physical disorder | |
| DOID:0110122 | Axenfeld-Rieger syndrome type 3 | |
| DOID:18 | urinary system disease |
