GlyCosmos Portal

Submissions

Kit ligand

Summary

UniProt ID: P21581
Gene Symbol: Kitl Kitlg Mgf
Gene ID: 60427
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen: P21581
PubChem: P21581
The Human Metabolome Database: HMDBP12086
Re-Glyco: P21581

Annotation

Keyword: Alternative splicing Cell adhesion Cell membrane Cell projection Cytoskeleton Direct protein sequencing Disulfide bond Glycoprotein Growth factor Pyrrolidone carboxylic acid Reference proteome Secreted Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 31 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
ovarian follicle development	IDA	PMID
neural crest cell migration
hematopoietic progenitor cell differentiation
myeloid leukocyte differentiation
positive regulation of leukocyte migration

GO Hierarchy

biological process

immune system process [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

T cell proliferation

lymphocyte proliferation [inference]

T cell proliferation

leukocyte migration [inference]

myeloid leukocyte migration [inference]

mast cell migration

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

T cell proliferation

lymphocyte proliferation [inference]

T cell proliferation

cell adhesion

signal transduction [inference]

cell surface receptor signaling pathway [inference]

extrinsic apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway in absence of ligand

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction [inference]

Ras protein signal transduction

signal transduction in absence of ligand [inference]

extrinsic apoptotic signaling pathway in absence of ligand

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway in absence of ligand

cell death [inference]

programmed cell death [inference]

apoptotic process [inference]

myeloid cell apoptotic process [inference]

mast cell apoptotic process

leukocyte apoptotic process [inference]

mast cell apoptotic process

programmed cell death involved in cell development [inference]

ectopic germ cell programmed cell death

cell population proliferation [inference]

leukocyte proliferation [inference]

mononuclear cell proliferation [inference]

lymphocyte proliferation [inference]

T cell proliferation

mast cell proliferation

cellular developmental process [inference]

programmed cell death involved in cell development [inference]

ectopic germ cell programmed cell death

cell differentiation [inference]

hematopoietic progenitor cell differentiation

leukocyte differentiation [inference]

myeloid leukocyte differentiation

myeloid cell differentiation [inference]

myeloid leukocyte differentiation

cell development [inference]

hemopoiesis [inference]

embryonic hemopoiesis

cell motility [inference]

cell migration [inference]

ameboidal-type cell migration [inference]

epithelial cell migration [inference]

melanocyte migration

mesenchymal cell migration [inference]

neural crest cell migration

leukocyte migration [inference]

myeloid leukocyte migration [inference]

mast cell migration

reproductive process [inference]

developmental process involved in reproduction [inference]

ectopic germ cell programmed cell death

reproductive structure development [inference]

gonad development [inference]

male gonad development

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

T cell proliferation

lymphocyte proliferation [inference]

T cell proliferation

developmental process [inference]

developmental process involved in reproduction [inference]

ectopic germ cell programmed cell death

reproductive structure development [inference]

gonad development [inference]

male gonad development

anatomical structure development [inference]

ovarian follicle development

cell development [inference]

hemopoiesis [inference]

embryonic hemopoiesis

animal organ development [inference]

gonad development [inference]

male gonad development

embryonic organ development [inference]

embryonic hemopoiesis

reproductive structure development [inference]

gonad development [inference]

male gonad development

cellular developmental process [inference]

programmed cell death involved in cell development [inference]

ectopic germ cell programmed cell death

cell differentiation [inference]

hematopoietic progenitor cell differentiation

leukocyte differentiation [inference]

myeloid leukocyte differentiation

myeloid cell differentiation [inference]

myeloid leukocyte differentiation

cell development [inference]

hemopoiesis [inference]

embryonic hemopoiesis

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of mast cell apoptotic process

positive regulation of immune system process [inference]

positive regulation of leukocyte migration

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

regulation of mast cell apoptotic process [inference]

negative regulation of mast cell apoptotic process

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of intracellular signal transduction [inference]

regulation of small GTPase mediated signal transduction [inference]

regulation of Ras protein signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration

positive regulation of cell migration [inference]

positive regulation of leukocyte migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration

positive regulation of developmental pigmentation [inference]

positive regulation of pigment cell differentiation [inference]

positive regulation of melanocyte differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of mast cell proliferation

positive regulation of stem cell proliferation [inference]

positive regulation of hematopoietic stem cell proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of pigment cell differentiation [inference]

positive regulation of melanocyte differentiation

positive regulation of hematopoietic progenitor cell differentiation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of pigment cell differentiation [inference]

positive regulation of melanocyte differentiation

positive regulation of hematopoietic progenitor cell differentiation

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of mast cell apoptotic process

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of mast cell apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of mast cell apoptotic process

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of intracellular signal transduction [inference]

regulation of small GTPase mediated signal transduction [inference]

regulation of Ras protein signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of developmental process [inference]

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of pigment cell differentiation [inference]

positive regulation of melanocyte differentiation

positive regulation of hematopoietic progenitor cell differentiation

regulation of pigment cell differentiation [inference]

regulation of melanocyte differentiation [inference]

positive regulation of melanocyte differentiation

positive regulation of pigment cell differentiation [inference]

positive regulation of melanocyte differentiation

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of hematopoietic progenitor cell differentiation [inference]

positive regulation of hematopoietic progenitor cell differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of pigment cell differentiation [inference]

positive regulation of melanocyte differentiation

positive regulation of hematopoietic progenitor cell differentiation

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

extrinsic apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway in absence of ligand

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction [inference]

Ras protein signal transduction

signal transduction in absence of ligand [inference]

extrinsic apoptotic signaling pathway in absence of ligand

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway in absence of ligand

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of intracellular signal transduction [inference]

regulation of small GTPase mediated signal transduction [inference]

regulation of Ras protein signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of cell adhesion [inference]

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of mast cell proliferation

positive regulation of stem cell proliferation [inference]

positive regulation of hematopoietic stem cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of mast cell proliferation

regulation of mast cell proliferation [inference]

positive regulation of mast cell proliferation

regulation of stem cell proliferation [inference]

regulation of hematopoietic stem cell proliferation [inference]

positive regulation of hematopoietic stem cell proliferation

positive regulation of stem cell proliferation [inference]

positive regulation of hematopoietic stem cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

regulation of myeloid cell apoptotic process [inference]

regulation of mast cell apoptotic process [inference]

negative regulation of mast cell apoptotic process

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of mast cell apoptotic process

negative regulation of apoptotic process

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of mast cell apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of mast cell apoptotic process

regulation of leukocyte apoptotic process [inference]

regulation of mast cell apoptotic process [inference]

negative regulation of mast cell apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of mast cell apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of mast cell apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of mast cell apoptotic process

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of pigment cell differentiation [inference]

positive regulation of melanocyte differentiation

positive regulation of hematopoietic progenitor cell differentiation

regulation of pigment cell differentiation [inference]

regulation of melanocyte differentiation [inference]

positive regulation of melanocyte differentiation

positive regulation of pigment cell differentiation [inference]

positive regulation of melanocyte differentiation

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of hematopoietic progenitor cell differentiation [inference]

positive regulation of hematopoietic progenitor cell differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of mast cell proliferation

positive regulation of stem cell proliferation [inference]

positive regulation of hematopoietic stem cell proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of pigment cell differentiation [inference]

positive regulation of melanocyte differentiation

positive regulation of hematopoietic progenitor cell differentiation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of mast cell apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of mast cell apoptotic process

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration

positive regulation of cell migration [inference]

positive regulation of leukocyte migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation

regulation of pigmentation [inference]

regulation of developmental pigmentation [inference]

positive regulation of developmental pigmentation [inference]

positive regulation of pigment cell differentiation [inference]

positive regulation of melanocyte differentiation

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
cytoplasm	ISS	GO_REF
cytoplasm	ISO	GO_REF
cytoplasm	IEA	GO_REF GO_REF
cytoskeleton	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

membrane

plasma membrane

cell projection [inference]

plasma membrane bounded cell projection [inference]

lamellipodium

actin-based cell projection [inference]

filopodium

organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton

intracellular organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton

Displaying **all 3** entries
GO Term	Evidence Code	Reference
cytokine activity	IEA	GO_REF
stem cell factor receptor binding	IEA	GO_REF GO_REF
growth factor activity

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

stem cell factor receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Site Annotations

Displaying 1 entry
Position	Description
97	Not glycosylated

Annotation information from UniProt.

Sequence

MKKTQTWIITCIYLQLLLFNPLVKTQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKSPEDPGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	PubMed ID	Source
90	N-linked (GlcNAc...) asparagine; partial	1708771	UniProt GlyGen
145	N-linked (GlcNAc...) asparagine	1708771	UniProt GlyGen
167	O-linked (GalNAc...) serine	1708771	UniProt GlyGen
168	O-linked (GalNAc...) threonine	1708771	UniProt GlyGen
180	O-linked (GalNAc...) threonine	1708771	UniProt GlyGen
195	N-linked (GlcNAc...) asparagine		UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
PI3K/AKT Signaling	Rattus norvegicus
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling	Rattus norvegicus
RAF/MAP kinase cascade	Rattus norvegicus
Regulation of KIT signaling	Rattus norvegicus
Signaling by SCF-KIT	Rattus norvegicus
Transcriptional and post-translational regulation of MITF-M expression and activity	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements