GlyCosmos Portal

Submissions

Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

Summary

UniProt ID: P21913
Gene Symbol: Sdh1 Sdhb
Gene ID: 298596
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen: P21913
PubChem: P21913
The O-GlcNAc Database: P21913
O-GlcNAcAtlas: P21913
Re-Glyco: P21913

Annotation

Keyword: 2Fe-2S 3Fe-4S 4Fe-4S Acetylation Electron transport Mitochondrion inner membrane Oxidoreductase Reference proteome Transit peptide Tricarboxylic acid cycle

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
tricarboxylic acid cycle	ISO	GO_REF
tricarboxylic acid cycle	NAS	PMID
tricarboxylic acid cycle	IEA	GO_REF GO_REF GO_REF
succinate metabolic process	IMP	PMID
mitochondrial electron transport, succinate to ubiquinone	NAS	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

generation of precursor metabolites and energy [inference]

energy derivation by oxidation of organic compounds [inference]

cellular respiration [inference]

aerobic respiration

aerobic electron transport chain [inference]

mitochondrial electron transport, succinate to ubiquinone

electron transport chain [inference]

respiratory electron transport chain

aerobic electron transport chain [inference]

mitochondrial electron transport, succinate to ubiquinone

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

biosynthetic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

primary metabolic process [inference]

tricarboxylic acid cycle

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

small molecule metabolic process [inference]

organic acid metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

dicarboxylic acid metabolic process [inference]

succinate metabolic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

carbohydrate derivative metabolic process [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
nucleoplasm
mitochondrion	ISO	GO_REF
mitochondrion	IEA	GO_REF
mitochondrial inner membrane	ISS	GO_REF
mitochondrial inner membrane	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

respiratory chain complex II (succinate dehydrogenase)

respiratory chain complex [inference]

respiratory chain complex II (succinate dehydrogenase)

catalytic complex [inference]

oxidoreductase complex [inference]

respiratory chain complex II (succinate dehydrogenase)

cellular anatomical structure [inference]

nucleoplasm

membrane [inference]

plasma membrane

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane

mitochondrial inner membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
succinate dehydrogenase (quinone) activity	ISS	GO_REF
succinate dehydrogenase (quinone) activity	ISO	GO_REF
succinate dehydrogenase (quinone) activity	IEA	GO_REF GO_REF GO_REF
electron transfer activity	IEA	GO_REF
metal ion binding

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

oxidoreductase activity, acting on the CH-CH group of donors [inference]

succinate dehydrogenase activity [inference]

succinate dehydrogenase (quinone) activity

oxidoreductase activity, acting on the CH-CH group of donors, quinone or related compound as acceptor [inference]

succinate dehydrogenase (quinone) activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

quinone binding [inference]

ubiquinone binding

metal cluster binding [inference]

iron-sulfur cluster binding [inference]

electron transfer activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAVVGVSLKRGFSATALGRVGLQFQACREAQTAAAAAPRIKTFAIYRWDPDKAGDKPRMQTYKVDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTDLGKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLAKLQDPFSLYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKRALA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites