GlyCosmos Portal

Submissions

Interleukin-6 receptor subunit alpha

Summary

UniProt ID: P22273
Gene Symbol: Il6r Il6ra
Gene ID
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: P22273
Re-Glyco: P22273

Annotation

Keyword: Cell membrane Disulfide bond Glycoprotein Immunoglobulin domain Receptor Reference proteome Secreted Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 30 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
cell surface receptor signaling pathway via JAK-STAT	ISO	GO_REF
positive regulation of cell population proliferation	ISO	GO_REF
positive regulation of cell population proliferation	IMP	PMID
positive regulation of cell population proliferation	IBA	GO_REF
response to gamma radiation	IEP	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway

cell surface receptor signaling pathway via STAT

cell surface receptor signaling pathway via JAK-STAT

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression [inference]

cytokine production [inference]

vascular endothelial growth factor production

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression [inference]

cytokine production [inference]

vascular endothelial growth factor production

cellular developmental process [inference]

cell fate commitment [inference]

T cell lineage commitment [inference]

alpha-beta T cell lineage commitment [inference]

CD4-positive, alpha-beta T cell lineage commitment [inference]

T-helper cell lineage commitment [inference]

T-helper 17 cell lineage commitment

CD4-positive or CD8-positive, alpha-beta T cell lineage commitment [inference]

CD4-positive, alpha-beta T cell lineage commitment [inference]

T-helper cell lineage commitment [inference]

T-helper 17 cell lineage commitment

multicellular organismal process [inference]

cytokine production [inference]

vascular endothelial growth factor production

developmental process [inference]

anatomical structure development [inference]

endocrine pancreas development

cellular developmental process [inference]

cell fate commitment [inference]

T cell lineage commitment [inference]

alpha-beta T cell lineage commitment [inference]

CD4-positive, alpha-beta T cell lineage commitment [inference]

T-helper cell lineage commitment [inference]

T-helper 17 cell lineage commitment

CD4-positive or CD8-positive, alpha-beta T cell lineage commitment [inference]

CD4-positive, alpha-beta T cell lineage commitment [inference]

T-helper cell lineage commitment [inference]

T-helper 17 cell lineage commitment

growth [inference]

developmental growth

response to stimulus [inference]

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

response to abiotic stimulus [inference]

response to radiation [inference]

response to ionizing radiation [inference]

response to gamma radiation

response to endogenous stimulus [inference]

response to hormone [inference]

response to peptide hormone

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

response to chemical [inference]

response to hormone [inference]

response to peptide hormone

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

response to lipid [inference]

response to lipopolysaccharide

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

response to organophosphorus [inference]

response to cAMP

response to peptide [inference]

response to cytokine

response to nitrogen compound [inference]

response to purine-containing compound [inference]

response to cAMP

response to peptide hormone

response to oxygen-containing compound [inference]

response to alcohol [inference]

response to ethanol

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

positive regulation of cell proliferation involved in kidney development [inference]

positive regulation of glomerular mesangial cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion [inference]

positive regulation of platelet aggregation

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of collagen biosynthetic process

negative regulation of collagen metabolic process [inference]

negative regulation of collagen biosynthetic process

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway

cell surface receptor signaling pathway via STAT

cell surface receptor signaling pathway via JAK-STAT

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of collagen biosynthetic process

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

regulation of chemokine production [inference]

positive regulation of chemokine production

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

regulation of collagen biosynthetic process [inference]

negative regulation of collagen biosynthetic process

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of collagen biosynthetic process

negative regulation of collagen metabolic process [inference]

negative regulation of collagen biosynthetic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

regulation of collagen metabolic process [inference]

negative regulation of collagen metabolic process [inference]

negative regulation of collagen biosynthetic process

regulation of collagen biosynthetic process [inference]

negative regulation of collagen biosynthetic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

regulation of chemokine production [inference]

positive regulation of chemokine production

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

regulation of cell adhesion [inference]

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion [inference]

positive regulation of platelet aggregation

regulation of homotypic cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion [inference]

positive regulation of platelet aggregation

regulation of platelet aggregation [inference]

positive regulation of platelet aggregation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion [inference]

positive regulation of platelet aggregation

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

positive regulation of cell proliferation involved in kidney development [inference]

positive regulation of glomerular mesangial cell proliferation

regulation of smooth muscle cell proliferation [inference]

positive regulation of smooth muscle cell proliferation

regulation of glomerular mesangial cell proliferation [inference]

positive regulation of glomerular mesangial cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

positive regulation of cell proliferation involved in kidney development [inference]

positive regulation of glomerular mesangial cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion [inference]

positive regulation of platelet aggregation

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of collagen biosynthetic process

negative regulation of collagen metabolic process [inference]

negative regulation of collagen biosynthetic process

regulation of cell activation [inference]

regulation of platelet activation [inference]

regulation of platelet aggregation [inference]

positive regulation of platelet aggregation

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

regulation of chemokine production [inference]

positive regulation of chemokine production

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

regulation of cell activation [inference]

regulation of platelet activation [inference]

regulation of platelet aggregation [inference]

positive regulation of platelet aggregation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	ISO	GO_REF
extracellular region	IDA	PMID
extracellular region	IEA	GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex

plasma membrane signaling receptor complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

plasma membrane signaling receptor complex [inference]

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

plasma membrane region [inference]

apical plasma membrane

cell body membrane [inference]

neuronal cell body membrane

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
cytokine receptor activity	ISO	GO_REF
cytokine receptor activity	IEA	GO_REF
interleukin-6 receptor activity	ISS	GO_REF
interleukin-6 receptor activity	ISO	GO_REF
interleukin-11 receptor activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

growth factor binding [inference]

enzyme binding

cytokine binding [inference]

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

cytokine receptor activity

immune receptor activity [inference]

cytokine receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLAVGCTLLVALLAAPAVALVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNATIHWVYSGSQSREWTTTGNTLVLRAVQVNDTGHYLCFLDDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAFCEWHPSSTPSPTTKAVMFAKKINTTNGKSDFQVPCQYSQQLKSFSCEVEILEGDKVYHIVSLCVANSVGSRSSHNVVFQSLKMVQPDPPANLVVSAIPGXPRWLKVSWQDPESWDPSYYLLQFELRYRPVWSKXFTVWPLQVAQHQCVIHDALRGVKHVVQVRGKEEFDIGQWSKWSPEVTGTPWLAEPRTTPAGIPGNPTQVSVEDYDNHEDQYGSSTEATSVLAPVQGSSPIPLPTFLVAGGSLAFGLLLCVFIILRLKKKWKSQAEKESKTTSPPPYPLGPLKPTFLLVPLLTPSGSHNSSGTDNTGSHSCLGVRDPQCPNDNSNRDYLFPR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	Source
32	N-linked (GlcNAc...) asparagine	UniProt
55	N-linked (GlcNAc...) asparagine	UniProt
85	N-linked (GlcNAc...) asparagine	UniProt
150	N-linked (GlcNAc...) asparagine	UniProt
218	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Activation of STAT3 by cadherin engagement	Rattus norvegicus
Interleukin-6 signaling	Rattus norvegicus
MAPK1 (ERK2) activation	Rattus norvegicus
MAPK3 (ERK1) activation	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements