GlyCosmos Portal

Submissions

Metabotropic glutamate receptor 1

Summary

UniProt ID: P23385
Gene Symbol: Grm1 Gprc1a Mglur1
Gene ID: 24414
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen: P23385
PubChem: P23385
Re-Glyco: P23385

Annotation

Keyword: 3D-structure Alternative splicing Cell membrane Cell projection Disulfide bond G-protein coupled receptor Glycoprotein Phosphoprotein Postsynaptic cell membrane Reference proteome Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 22 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
G protein-coupled receptor signaling pathway	ISO	GO_REF
G protein-coupled receptor signaling pathway	IEA	GO_REF
phospholipase C-activating G protein-coupled receptor signaling pathway	ISO	GO_REF
phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	PMID
phospholipase C-activating G protein-coupled glutamate receptor signaling pathway	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission

synaptic transmission, GABAergic

synaptic signaling via neuropeptide

signal transduction [inference]

cell surface receptor signaling pathway [inference]

glutamate receptor signaling pathway [inference]

G protein-coupled glutamate receptor signaling pathway

phospholipase C-activating G protein-coupled glutamate receptor signaling pathway

G protein-coupled receptor signaling pathway

phospholipase C-activating G protein-coupled receptor signaling pathway

phospholipase C-activating G protein-coupled glutamate receptor signaling pathway

G protein-coupled glutamate receptor signaling pathway

phospholipase C-activating G protein-coupled glutamate receptor signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

calcium-mediated signaling

cellular response to stimulus [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to electrical stimulus

transmembrane transport [inference]

amino acid transmembrane transport [inference]

amino acid import across plasma membrane [inference]

L-glutamate import across plasma membrane

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport [inference]

L-glutamate import across plasma membrane

import across plasma membrane [inference]

amino acid import across plasma membrane [inference]

L-glutamate import across plasma membrane

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport [inference]

L-glutamate import across plasma membrane

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

sensory perception [inference]

sensory perception of pain

behavior [inference]

locomotory behavior

response to stimulus [inference]

response to abiotic stimulus [inference]

response to electrical stimulus [inference]

cellular response to electrical stimulus

cellular response to abiotic stimulus [inference]

cellular response to electrical stimulus

cellular response to stimulus [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to electrical stimulus

localization [inference]

establishment of localization [inference]

transport [inference]

amino acid transport [inference]

amino acid transmembrane transport [inference]

amino acid import across plasma membrane [inference]

L-glutamate import across plasma membrane

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport [inference]

L-glutamate import across plasma membrane

acidic amino acid transport [inference]

L-glutamate import [inference]

L-glutamate transmembrane transport [inference]

L-glutamate import across plasma membrane

L-amino acid transport [inference]

L-glutamate import [inference]

L-glutamate transmembrane transport [inference]

L-glutamate import across plasma membrane

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport [inference]

L-glutamate import across plasma membrane

organic acid transport [inference]

carboxylic acid transport [inference]

dicarboxylic acid transport [inference]

L-glutamate import [inference]

L-glutamate transmembrane transport [inference]

L-glutamate import across plasma membrane

L-amino acid transport [inference]

L-glutamate import [inference]

L-glutamate transmembrane transport [inference]

L-glutamate import across plasma membrane

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport [inference]

L-glutamate import across plasma membrane

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport [inference]

L-glutamate import across plasma membrane

transmembrane transport [inference]

amino acid transmembrane transport [inference]

amino acid import across plasma membrane [inference]

L-glutamate import across plasma membrane

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport [inference]

L-glutamate import across plasma membrane

import across plasma membrane [inference]

amino acid import across plasma membrane [inference]

L-glutamate import across plasma membrane

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport [inference]

L-glutamate import across plasma membrane

nitrogen compound transport [inference]

L-amino acid transport [inference]

L-glutamate import [inference]

L-glutamate transmembrane transport [inference]

L-glutamate import across plasma membrane

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport [inference]

L-glutamate import across plasma membrane

import into cell [inference]

import across plasma membrane [inference]

amino acid import across plasma membrane [inference]

L-glutamate import across plasma membrane

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic transmission, glutamatergic

signaling [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission

synaptic transmission, GABAergic

synaptic signaling via neuropeptide

regulation of localization [inference]

regulation of transport [inference]

regulation of organic acid transport [inference]

regulation of glutamate secretion

regulation of secretion [inference]

regulation of secretion by cell [inference]

regulation of glutamate secretion

regulation of amine transport [inference]

regulation of amino acid transport [inference]

regulation of glutamate secretion

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

glutamate receptor signaling pathway [inference]

G protein-coupled glutamate receptor signaling pathway

phospholipase C-activating G protein-coupled glutamate receptor signaling pathway

G protein-coupled receptor signaling pathway

phospholipase C-activating G protein-coupled receptor signaling pathway

phospholipase C-activating G protein-coupled glutamate receptor signaling pathway

G protein-coupled glutamate receptor signaling pathway

phospholipase C-activating G protein-coupled glutamate receptor signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

calcium-mediated signaling

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic transmission, glutamatergic

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of secretion by cell [inference]

regulation of glutamate secretion

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of nervous system process [inference]

regulation of sensory perception [inference]

regulation of sensory perception of pain

regulation of biological quality [inference]

regulation of membrane potential [inference]

membrane depolarization

Displaying entries **1 - 5** of 30 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISO	GO_REF
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF
plasma membrane	TAS	Reactome
plasma membrane	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex [inference]

plasma membrane signaling receptor complex [inference]

G protein-coupled receptor complex [inference]

G protein-coupled receptor dimeric complex

G protein-coupled receptor homodimeric complex

membrane protein complex [inference]

plasma membrane protein complex [inference]

plasma membrane signaling receptor complex [inference]

G protein-coupled receptor complex [inference]

G protein-coupled receptor dimeric complex

G protein-coupled receptor homodimeric complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

plasma membrane region [inference]

synaptic membrane [inference]

postsynaptic specialization membrane [inference]

postsynaptic density membrane

cell junction [inference]

synapse [inference]

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection

neuron spine

dendritic spine

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

postsynaptic specialization [inference]

postsynaptic density

dendrite terminus [inference]

dendriole

cell body [inference]

neuronal cell body

postsynapse [inference]

dendritic spine

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
PLC activating G protein-coupled glutamate receptor activity	TAS	PMID
PLC activating G protein-coupled glutamate receptor activity	IEA	GO_REF
adenylate cyclase inhibiting G protein-coupled glutamate receptor activity	IBA	GO_REF
G protein-coupled receptor activity	TAS	PMID
G protein-coupled receptor activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

transcription factor binding [inference]

DNA-binding transcription factor binding [inference]

RNA polymerase II-specific DNA-binding transcription factor binding [inference]

nuclear receptor binding [inference]

nuclear estrogen receptor binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity

G protein-coupled glutamate receptor activity [inference]

G protein-coupled receptor activity involved in regulation of postsynaptic membrane potential

glutamate receptor activity

G protein-coupled glutamate receptor activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVRLLLIFFPMIFLEMSILPRMPDRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGLNRCLPDGQTLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGMVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEFVQDEFTCRACDLGWWPNAELTGCEPIPVRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPVGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKPGAGNANSNGKSVSWSEPGGRQAPKGQHVWQRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDASTKTLYNVEEEDNTPSAHFSPPSSPSMVVHRRGPPVATTPPLPPHLTAEETPLFLADSVIPKGLPPPLPQQQPQQPPPQQPPQQPKSLMDQLQGVVTNFGSGIPDFHAVLAGPGTPGNSLRSLYPPPPPPQHLQMLPLHLSTFQEESISPPGEDIDDDSERFKLLQEFVYEREGNTEEDELEEEEDLPTASKLTPEDSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVTYASVILRDYKQSSSTL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	PubMed ID	Source
98	N-linked (GlcNAc...) asparagine	11069170	UniProt GlyGen
223	N-linked (GlcNAc...) asparagine	11069170	UniProt GlyGen
397	N-linked (GlcNAc...) asparagine		UniProt GlyGen
515	N-linked (GlcNAc...) asparagine		UniProt GlyGen
1064			GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Class C/3 (Metabotropic glutamate/pheromone receptors)	Rattus norvegicus
G alpha (q) signalling events	Rattus norvegicus
Neurexins and neuroligins	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements