GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Interleukin-1 receptor antagonist protein

Summary

UniProt ID: P25085
Gene Symbol: Il-1ra Il1rn
Gene ID: 16181
Organism: Mus musculus (house mouse)

External Links

GlyGen: P25085
PubChem: P25085
Re-Glyco: P25085

Annotation

Keyword: Alternative splicing Cytoplasm Disulfide bond Glycoprotein Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 20 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
fever generation	ISO	GO_REF
lipid metabolic process	IMP	PMID
acute-phase response	ISO	GO_REF
inflammatory response	IBA	GO_REF
inflammatory response	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response

cellular process [inference]

metabolic process [inference]

primary metabolic process [inference]

lipid metabolic process

export from cell [inference]

secretion by cell [inference]

protein secretion [inference]

insulin secretion

signal release [inference]

hormone secretion [inference]

peptide hormone secretion [inference]

insulin secretion

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

cognition [inference]

learning or memory [inference]

memory

behavior [inference]

learning or memory [inference]

memory

multicellular organismal-level homeostasis [inference]

temperature homeostasis [inference]

heat generation [inference]

fever generation

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

temperature homeostasis [inference]

heat generation [inference]

fever generation

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response

acute inflammatory response [inference]

acute-phase response

fever generation

immune response

response to endogenous stimulus [inference]

response to hormone [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

response to chemical [inference]

response to hormone [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

response to lipid [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

protein secretion [inference]

insulin secretion

protein localization to extracellular region [inference]

protein secretion [inference]

insulin secretion

establishment of localization [inference]

transport [inference]

hormone transport [inference]

hormone secretion [inference]

peptide hormone secretion [inference]

insulin secretion

protein transport [inference]

protein secretion [inference]

insulin secretion

peptide transport [inference]

peptide secretion [inference]

peptide hormone secretion [inference]

insulin secretion

secretion [inference]

peptide secretion [inference]

peptide hormone secretion [inference]

insulin secretion

secretion by cell [inference]

protein secretion [inference]

insulin secretion

signal release [inference]

hormone secretion [inference]

peptide hormone secretion [inference]

insulin secretion

nitrogen compound transport [inference]

peptide hormone secretion [inference]

insulin secretion

export from cell [inference]

secretion by cell [inference]

protein secretion [inference]

insulin secretion

signal release [inference]

hormone secretion [inference]

peptide hormone secretion [inference]

insulin secretion

establishment of protein localization [inference]

protein transport [inference]

protein secretion [inference]

insulin secretion

establishment of protein localization to extracellular region [inference]

protein secretion [inference]

insulin secretion

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

regulation of interleukin-1-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

regulation of localization [inference]

regulation of transport [inference]

regulation of organic acid transport [inference]

regulation of glutamate secretion [inference]

negative regulation of glutamate secretion

negative regulation of organic acid transport [inference]

negative regulation of glutamate secretion

regulation of secretion [inference]

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of glutamate secretion

regulation of secretion by cell [inference]

regulation of glutamate secretion [inference]

negative regulation of glutamate secretion

negative regulation of secretion by cell [inference]

negative regulation of glutamate secretion

negative regulation of transport [inference]

negative regulation of organic acid transport [inference]

negative regulation of glutamate secretion

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of glutamate secretion

negative regulation of amine transport [inference]

negative regulation of amino acid transport [inference]

negative regulation of glutamate secretion

regulation of amine transport [inference]

negative regulation of amine transport [inference]

negative regulation of amino acid transport [inference]

negative regulation of glutamate secretion

regulation of amino acid transport [inference]

regulation of glutamate secretion [inference]

negative regulation of glutamate secretion

negative regulation of amino acid transport [inference]

negative regulation of glutamate secretion

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of heterotypic cell-cell adhesion

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of secretion by cell [inference]

negative regulation of glutamate secretion

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of transport [inference]

negative regulation of organic acid transport [inference]

negative regulation of glutamate secretion

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of glutamate secretion

negative regulation of amine transport [inference]

negative regulation of amino acid transport [inference]

negative regulation of glutamate secretion

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

regulation of interleukin-1-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

regulation of response to cytokine stimulus [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

regulation of interleukin-1-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

regulation of interleukin-1-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of heterotypic cell-cell adhesion

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of heterotypic cell-cell adhesion

regulation of heterotypic cell-cell adhesion [inference]

negative regulation of heterotypic cell-cell adhesion

regulation of cell-cell adhesion involved in gastrulation [inference]

negative regulation of heterotypic cell-cell adhesion

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of heterotypic cell-cell adhesion

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of secretion by cell [inference]

negative regulation of glutamate secretion

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of secretion by cell [inference]

regulation of glutamate secretion [inference]

negative regulation of glutamate secretion

negative regulation of secretion by cell [inference]

negative regulation of glutamate secretion

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone transport [inference]

hormone secretion [inference]

peptide hormone secretion [inference]

insulin secretion

regulation of membrane potential [inference]

negative regulation of membrane potential

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	ISO	GO_REF GO_REF
extracellular region	IDA	PMID
extracellular region	IEA	GO_REF GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

cellular anatomical structure [inference]

microtubule organizing center [inference]

centrosome

cytosol

organelle [inference]

membrane-bounded organelle [inference]

vesicle

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
cytokine activity	IEA	GO_REF
interleukin-1 receptor binding	ISO	GO_REF GO_REF
interleukin-1 receptor binding	IEA	GO_REF
interleukin-1, type I receptor binding	ISO	GO_REF
interleukin-1, type I receptor binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

interleukin-1 receptor binding

interleukin-1 receptor antagonist activity

growth factor receptor binding [inference]

interleukin-1 receptor binding

growth factor binding [inference]

interleukin-1 binding [inference]

interleukin-1 receptor antagonist activity

cytokine binding [inference]

interleukin-1 binding [inference]

interleukin-1 receptor antagonist activity

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

signaling receptor inhibitor activity [inference]

receptor antagonist activity [inference]

interleukin-1 receptor antagonist activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

molecular function inhibitor activity [inference]

signaling receptor inhibitor activity [inference]

receptor antagonist activity [inference]

interleukin-1 receptor antagonist activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEICWGPYSHLISLLLILLFHSEAACRPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
110	N-linked (GlcNAc...) asparagine			UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Interleukin-1 signaling	Mus musculus

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026