GlyCosmos Portal

Submissions

Beta-nerve growth factor

Summary

UniProt ID: P25427
Gene Symbol: Ngf Ngfb
Gene ID: 310738
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: P25427
Re-Glyco: P25427

Annotation

Keyword: Cleavage on pair of basic residues Disulfide bond Endosome Glycoprotein Growth factor Lipid-binding Metalloprotease inhibitor Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **11 - 15** of 59 in total

« First

‹ Prev

1

2

3

4

5

6

7

…

Next ›

Last »
GO Term	Evidence Code	Reference
extrinsic apoptotic signaling pathway via death domain receptors	ISO	GO_REF
response to xenobiotic stimulus	IEP	PMID PMID PMID
response to mechanical stimulus	IEP	PMID
response to ozone	IEP	PMID
positive regulation of gene expression	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway

neurotrophin TRK receptor signaling pathway

neurotrophin signaling pathway [inference]

extrinsic apoptotic signaling pathway [inference]

signal transduction in absence of ligand [inference]

extrinsic apoptotic signaling pathway in absence of ligand

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway [inference]

cell death [inference]

programmed cell death [inference]

apoptotic process [inference]

neuron apoptotic process

cell population proliferation

neural precursor cell proliferation [inference]

cell proliferation in forebrain

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis

plasma membrane bounded cell projection organization [inference]

neuron projection development

reproductive process [inference]

developmental process involved in reproduction [inference]

spermatogenesis

multicellular organismal reproductive process [inference]

gamete generation [inference]

male gamete generation [inference]

spermatogenesis

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

sensory perception [inference]

sensory perception of pain

sensory perception of temperature stimulus [inference]

thermoception [inference]

sensory perception of hot stimulus

cognition [inference]

learning or memory [inference]

memory

behavior [inference]

learning or memory [inference]

memory

locomotory behavior [inference]

adult locomotory behavior

adult behavior [inference]

adult locomotory behavior

developmental process [inference]

developmental process involved in reproduction [inference]

spermatogenesis

anatomical structure morphogenesis [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis

anatomical structure development [inference]

nerve development

system development [inference]

peripheral nervous system development

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation

rhythmic process [inference]

circadian rhythm

response to stimulus [inference]

response to stress [inference]

response to oxidative stress [inference]

response to reactive oxygen species [inference]

response to ozone

response to external stimulus [inference]

response to mechanical stimulus

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

response to abiotic stimulus [inference]

response to endogenous stimulus [inference]

response to hormone [inference]

response to peptide hormone

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

response to chemical [inference]

response to xenobiotic stimulus

response to hormone [inference]

response to peptide hormone

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

response to lipid [inference]

response to lipopolysaccharide

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

response to nicotine

response to nitrogen compound [inference]

response to peptide hormone

response to oxygen-containing compound [inference]

response to reactive oxygen species [inference]

response to ozone

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of neurotrophin TRK receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of neurotrophin TRK receptor signaling pathway [inference]

positive regulation of neurotrophin TRK receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of small GTPase mediated signal transduction [inference]

regulation of Ras protein signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of neurotrophin TRK receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission

regulation of neurotransmitter secretion

regulation of localization [inference]

regulation of transport [inference]

regulation of transmembrane transport [inference]

regulation of monoatomic ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of release of sequestered calcium ion into cytosol

regulation of monoatomic ion transport [inference]

regulation of metal ion transport [inference]

regulation of calcium ion transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of release of sequestered calcium ion into cytosol

regulation of monoatomic ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of release of sequestered calcium ion into cytosol

regulation of secretion [inference]

regulation of secretion by cell [inference]

regulation of neurotransmitter secretion

regulation of neurotransmitter transport [inference]

regulation of neurotransmitter secretion

regulation of growth [inference]

regulation of cell growth [inference]

positive regulation of cell growth

regulation of extent of cell growth [inference]

regulation of axon extension [inference]

positive regulation of axon extension

regulation of collateral sprouting [inference]

positive regulation of collateral sprouting

positive regulation of growth [inference]

positive regulation of cell growth

positive regulation of developmental growth [inference]

regulation of developmental growth [inference]

regulation of axon extension [inference]

positive regulation of axon extension

positive regulation of developmental growth [inference]

regulation of collateral sprouting [inference]

positive regulation of collateral sprouting

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of neurotrophin TRK receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of growth [inference]

positive regulation of cell growth

positive regulation of developmental growth [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of stem cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein autophosphorylation

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein autophosphorylation

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of neurotrophin TRK receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cell growth

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of cell maturation [inference]

positive regulation of neuron maturation

positive regulation of neuron differentiation

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

positive regulation of axonogenesis [inference]

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of neurotrophin TRK receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of cell maturation [inference]

positive regulation of neuron maturation

positive regulation of neuron differentiation

positive regulation of developmental growth [inference]

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of epithelial cell apoptotic process [inference]

negative regulation of type B pancreatic cell apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of response to endoplasmic reticulum stress [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of response to endoplasmic reticulum stress [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of neurotrophin TRK receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of neurotrophin TRK receptor signaling pathway [inference]

positive regulation of neurotrophin TRK receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of small GTPase mediated signal transduction [inference]

regulation of Ras protein signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of neurotrophin TRK receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of response to endoplasmic reticulum stress [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of response to endoplasmic reticulum stress [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of response to endoplasmic reticulum stress [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of neurotrophin TRK receptor signaling pathway [inference]

positive regulation of neurotrophin TRK receptor signaling pathway

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of axonogenesis [inference]

regulation of collateral sprouting [inference]

positive regulation of collateral sprouting

positive regulation of axonogenesis [inference]

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of cell maturation [inference]

positive regulation of neuron maturation

positive regulation of neuron differentiation

regulation of neuron differentiation

regulation of neuron maturation [inference]

positive regulation of neuron maturation

positive regulation of neuron differentiation

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of cell maturation [inference]

positive regulation of neuron maturation

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

regulation of cell maturation [inference]

regulation of neuron maturation [inference]

positive regulation of neuron maturation

positive regulation of cell maturation [inference]

positive regulation of neuron maturation

regulation of developmental growth [inference]

regulation of axon extension [inference]

positive regulation of axon extension

positive regulation of developmental growth [inference]

regulation of collateral sprouting [inference]

positive regulation of collateral sprouting

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of cell maturation [inference]

positive regulation of neuron maturation

positive regulation of neuron differentiation

positive regulation of developmental growth [inference]

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway

neurotrophin TRK receptor signaling pathway

neurotrophin signaling pathway [inference]

extrinsic apoptotic signaling pathway [inference]

signal transduction in absence of ligand [inference]

extrinsic apoptotic signaling pathway in absence of ligand

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of neurotrophin TRK receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of neurotrophin TRK receptor signaling pathway [inference]

positive regulation of neurotrophin TRK receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of small GTPase mediated signal transduction [inference]

regulation of Ras protein signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of neurotrophin TRK receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission

regulation of neurotransmitter secretion

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein autophosphorylation

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein autophosphorylation

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of phosphorus metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein autophosphorylation

regulation of phosphorylation [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein autophosphorylation

regulation of protein autophosphorylation [inference]

positive regulation of protein autophosphorylation

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein autophosphorylation

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein autophosphorylation

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein autophosphorylation

regulation of protein autophosphorylation [inference]

positive regulation of protein autophosphorylation

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein autophosphorylation

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of post-translational protein modification [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein ubiquitination [inference]

positive regulation of protein ubiquitination

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein autophosphorylation

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein autophosphorylation

regulation of protein autophosphorylation [inference]

positive regulation of protein autophosphorylation

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein autophosphorylation

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of post-translational protein modification [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein ubiquitination [inference]

positive regulation of protein ubiquitination

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein autophosphorylation

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of transmembrane transport [inference]

regulation of monoatomic ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of release of sequestered calcium ion into cytosol

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of stem cell proliferation

regulation of stem cell proliferation [inference]

positive regulation of stem cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of epithelial cell apoptotic process [inference]

negative regulation of type B pancreatic cell apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of neuron apoptotic process [inference]

negative regulation of neuron apoptotic process

regulation of epithelial cell apoptotic process [inference]

negative regulation of epithelial cell apoptotic process [inference]

negative regulation of type B pancreatic cell apoptotic process

regulation of type B pancreatic cell apoptotic process [inference]

negative regulation of type B pancreatic cell apoptotic process

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of epithelial cell apoptotic process [inference]

negative regulation of type B pancreatic cell apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of cell maturation [inference]

positive regulation of neuron maturation

positive regulation of neuron differentiation

regulation of neuron differentiation

regulation of neuron maturation [inference]

positive regulation of neuron maturation

positive regulation of neuron differentiation

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of cell maturation [inference]

positive regulation of neuron maturation

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

regulation of cell maturation [inference]

regulation of neuron maturation [inference]

positive regulation of neuron maturation

positive regulation of cell maturation [inference]

positive regulation of neuron maturation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of stem cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein autophosphorylation

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein autophosphorylation

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of neurotrophin TRK receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cell growth

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of cell maturation [inference]

positive regulation of neuron maturation

positive regulation of neuron differentiation

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

positive regulation of axonogenesis [inference]

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of epithelial cell apoptotic process [inference]

negative regulation of type B pancreatic cell apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of response to endoplasmic reticulum stress [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of cellular component organization [inference]

regulation of cell growth [inference]

positive regulation of cell growth

regulation of extent of cell growth [inference]

regulation of axon extension [inference]

positive regulation of axon extension

regulation of collateral sprouting [inference]

positive regulation of collateral sprouting

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

positive regulation of axonogenesis [inference]

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

positive regulation of neuron projection development

regulation of axonogenesis [inference]

regulation of collateral sprouting [inference]

positive regulation of collateral sprouting

positive regulation of axonogenesis [inference]

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

positive regulation of axonogenesis [inference]

regulation of cellular response to stress [inference]

regulation of response to endoplasmic reticulum stress [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of response to endoplasmic reticulum stress [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of secretion by cell [inference]

regulation of neurotransmitter secretion

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

regulation of molecular function [inference]

positive regulation of molecular function [inference]

positive regulation of binding [inference]

positive regulation of protein binding

regulation of binding [inference]

regulation of protein binding [inference]

positive regulation of protein binding

positive regulation of binding [inference]

positive regulation of protein binding

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	ISO	GO_REF
extracellular region	TAS	Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
extracellular region	IDA	PMID
extracellular region	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nerve growth factor receptor binding	IBA	GO_REF
growth factor activity	IBA	GO_REF
metalloendopeptidase inhibitor activity	ISS	GO_REF
metalloendopeptidase inhibitor activity	ISO	GO_REF
lipid binding

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

neurotrophin receptor binding [inference]

nerve growth factor receptor binding

tumor necrosis factor receptor superfamily binding [inference]

death receptor binding [inference]

nerve growth factor receptor binding

lipid binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

enzyme activator activity [inference]

peptidase activator activity [inference]

peptidase activator activity involved in apoptotic process [inference]

cysteine-type endopeptidase activator activity involved in apoptotic process

kinase activator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

kinase regulator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

protein kinase regulator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

cysteine-type endopeptidase regulator activity involved in apoptotic process [inference]

cysteine-type endopeptidase activator activity involved in apoptotic process

peptidase regulator activity [inference]

peptidase activator activity [inference]

peptidase activator activity involved in apoptotic process [inference]

cysteine-type endopeptidase activator activity involved in apoptotic process

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

endopeptidase regulator activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

receptor ligand activity [inference]

molecular function activator activity [inference]

enzyme activator activity [inference]

peptidase activator activity [inference]

peptidase activator activity involved in apoptotic process [inference]

cysteine-type endopeptidase activator activity involved in apoptotic process

kinase activator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

signaling receptor activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

receptor ligand activity [inference]

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSMLFYTLITAFLIGVQAEPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPAEPIAARVTGQTRNITVDPKLFKKRRLRSPRVLFSTQPPPTSSDTLDLDFQAHGTISFNRTHRSKRSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
69	N-linked (GlcNAc...) asparagine	UniProt
114	N-linked (GlcNAc...) asparagine	UniProt
166	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 12 in total

1

2

Next ›

Last »
Pathway Name	Organism
ARMS-mediated activation	Rattus norvegicus
Axonal growth stimulation	Rattus norvegicus
Frs2-mediated activation	Rattus norvegicus
NADE modulates death signalling	Rattus norvegicus
NF-kB is activated and signals survival	Rattus norvegicus
NFG and proNGF binds to p75NTR	Rattus norvegicus
NGF processing	Rattus norvegicus
NRIF signals cell death from the nucleus	Rattus norvegicus
PI3K/AKT activation	Rattus norvegicus
Retrograde neurotrophin signalling	Rattus norvegicus

Disease

Displaying **all 10** entries
DO ID	Disease Name	Source
DOID:13948	bladder neck obstruction	Alliance of Genome Resources
DOID:3525	middle cerebral artery infarction	Alliance of Genome Resources
DOID:0070355	overactive bladder syndrome	Alliance of Genome Resources
DOID:8947	diabetic retinopathy	Alliance of Genome Resources
DOID:1679	cystitis	Alliance of Genome Resources
DOID:90	degenerative disc disease	Alliance of Genome Resources
DOID:0080809	chronic asthma	Alliance of Genome Resources
DOID:0081292	traumatic brain injury	Alliance of Genome Resources
DOID:8398	osteoarthritis	Alliance of Genome Resources
DOID:12143	neurogenic bladder	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements